SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099841 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099841
Domain Number 1 Region: 118-203
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-21
Family Hormone receptor domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099841   Gene: FBgn0260753   Transcript: FBtr0070436
Sequence length 669
Comment type=protein; loc=X:join(2467034..2467463,2467533..2467643,2468505..2468656,2468896..2469153,2469225..2469521,2469588..2469851,2469927..2470087,2470150..2470486); ID=FBpp0099841; name=pdfr-PA; parent=FBgn0260753,FBtr0070436; dbxref=GB_protein:AAF45788.1,FlyBase_Annotation_IDs:CG13758-PA,FlyBase:FBpp0099841,GB_protein:AAF45788.2,REFSEQ:NP_570007,GB_protein:AAF45788,FlyMine:FBpp0099841,modMine:FBpp0099841; MD5=a565faec41a79f5e570e37a53e2e2a50; length=669; release=r5.30; species=Dmel;
Sequence
MTLLSNILDCGGCISAQRFTRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRV
PLLHDFDASTTESPGTYVLDGVARVAQLALEPTVMDALPDSDTEQVLGNLNSSAPWNLTL
ASAAATNFENCSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTR
KFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRT
RTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRR
GNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFP
LKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFC
FLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS
YGTHFLTSFQGFFIALIYCFLNGEVRAVLLKSLATQLSVRGHPEWAPKRASMYSGAYNTA
PDTDAVQPAGDPSATGKRISPPNKRLNGRKPSSASIVMIHEPQQRQRLMPRLQNKAREKG
KDRVEKTDAEAEPDPTISHIHSKEAGSARSRTRGSKWIMGICFRGQKVLRVPSASSVPPE
SVVFELSEQ
Download sequence
Identical sequences A0A158RFU8 Q9W4Y2
FBpp0099841 NP_570007.2.81976 FBpp0099841 7227.FBpp0099841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]