SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099971 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099971
Domain Number 1 Region: 86-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.1e-31
Family Skp1 dimerisation domain-like 0.000017
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily POZ domain 1.96e-19
Family BTB/POZ domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099971   Gene: FBgn0025637   Transcript: FBtr0100530
Sequence length 162
Comment type=protein; loc=X:551143..551631; ID=FBpp0099971; name=skpA-PH; parent=FBgn0025637,FBtr0100530; dbxref=FlyBase_Annotation_IDs:CG16983-PH,FlyBase:FBpp0099971,GB_protein:ABC67161.1,REFSEQ:NP_001033818,GB_protein:ABC67161,FlyMine:FBpp0099971,modMine:FBpp0099971; MD5=5b171fb8c53b7dc37f156d4c089bda5b; length=162; release=r5.30; species=Dmel;
Sequence
MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTW
AHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCK
TVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK
Download sequence
Identical sequences B4I948 B4R7G7 O77430
FBpp0214923 FBpp0200561 FBpp0070118 NP_001033818.1.81976 NP_001284755.1.81976 NP_477390.1.81976 NP_726690.1.81976 NP_726691.1.81976 NP_726692.1.81976 NP_726693.1.81976 NP_726694.1.81976 NP_726695.1.81976 XP_002040258.1.34323 XP_016037582.1.80810 XP_016037583.1.80810 XP_016037584.1.80810 FBpp0070118 FBpp0070119 FBpp0070120 FBpp0070121 FBpp0070122 FBpp0070123 FBpp0070124 FBpp0099971 7227.FBpp0070119 FBpp0070118 FBpp0070119 FBpp0070120 FBpp0070121 FBpp0070122 FBpp0070123 FBpp0070124 FBpp0099971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]