SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0100147 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100147
Domain Number 1 Region: 13-497
Classification Level Classification E-value
Superfamily ARM repeat 3.56e-17
Family HEAT repeat 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100147   Gene: FBgn0086784   Transcript: FBtr0301639
Sequence length 834
Comment type=protein; loc=2R:complement(4617232..4617384,4617569..4618193,4618254..4619117,4619186..4619316,4619427..4619468,4619665..4619910,4619970..4620123,4620181..4620385,4621297..4621381); ID=FBpp0100147; name=stmA-PC; parent=FBgn0086784,FBtr0301639; dbxref=FlyBase_Annotation_IDs:CG8739-PC,FlyBase:FBpp0100147,GB_protein:AAX52723.1,REFSEQ:NP_001014513,GB_protein:AAX52723,FlyMine:FBpp0100147,modMine:FBpp0100147; MD5=1920a0c42001f81fafdaf20bb302c3d4; length=834; release=r5.30; species=Dmel;
Sequence
MALIRCCFEPPELPEFFDSFVQKCTDPSCCCGCCSALRPRYKRLVDNIFPVNPEDGLVKS
NMEKLTFYSLSSPDKLDRIGEYLYQKATKDINRKRYKLAEIAMEAMDLLLQACHAQTTLN
LFVESFLRMVQKLLEDSNPNLKIMATNSFVKFANINEDTPSYHRRYDFFISKFSSMCHSD
AASMRDSLRLAGIKGLQGVIRKTVSDDLVENIWEAEHMEKIVPSLLFNMQFCVNVMFVKK
NLLASGDLTPVEDATNVTPPALAEEVLRELVGRASFGHIRSVLKPLLTHLDRHELWVPNT
FAIHTFRIVMISIQPQYSYTVVETLMQHLDNNFKSSPKTRTSLAVVLSKIIAIAAGESVG
PSALDIINNLLTHLRTSVSTTSEITPEESQYQEALINALGEFANHHPDYQKIEIMLFIMN
TVPDLSKKSKGDQMLQNILLKSLLKVGTQYSTVSFEKAFPASFLQPLLKMARAPHNPTRM
VVMQILQALLDRHQNEQVLSSVSVKPYPALSQEPPSRSDIIFTHKYGANIMQALIDSMAL
SDRVDALTSSFNTAALLIVEMSCNETVQEFLLFILGIQQVACTVDTLGNVHKCSLHAISI
GLLVLISRVSGINNLLEYAQKIVDARREEASHFLPPLLEPKKLAGKTFNLQLPHLAIDKL
ALGECLQNAGMDAQRLNTGAPYSLNQTDHPGHRHSWVESVSNQLTQRNSSADLTVYNGDV
DSVSSSPGVCKKLLAPEFNFDAMKRALAEPTEAAKREQRERQMQIVRTFREGEFDDLMRR
TEPKHDLIQNRLNELFNSLAVERQITQSDTKSSQLQASNEKPIYETNFPELFYY
Download sequence
Identical sequences Q8IGJ0
NP_001014513.1.81976 7227.FBpp0100147 FBpp0100147 FBpp0087794 FBpp0100147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]