SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0100174 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100174
Domain Number 1 Region: 58-199
Classification Level Classification E-value
Superfamily TRAF domain-like 3.27e-46
Family MATH domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 206-323
Classification Level Classification E-value
Superfamily POZ domain 2.44e-33
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100174   Gene: FBgn0086364   Transcript: FBtr0100852
Sequence length 403
Comment type=protein; loc=3R:complement(9794908..9795052,9795119..9795261,9795330..9795508,9795631..9795926,9796000..9796161,9796230..9796351,9796674..9796824,9849368..9849381); ID=FBpp0100174; name=rdx-PD; parent=FBgn0086364,FBtr0100852; dbxref=FlyBase:FBpp0100174,GB_protein:AAN14347.1,FlyBase:FBpp0082336,FlyBase_Annotation_IDs:CG12537-PD,FlyBase_Annotation_IDs:CG9924-PD,REFSEQ:NP_731875,GB_protein:AAN14347; MD5=23b567ba58cd371a59f9b6c7dd063cd2; length=403; release=r5.30; species=Dmel;
Sequence
MALARLPVNECQASQTARVTSNLHASSSTMAVSRVPSPPLPEVNTPVAENWCYTQVKVVK
FSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLV
SCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLP
EDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREF
QAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMAD
DLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATD
VMETSGWQNMITTHSHLIAEAFRALATQQIPPIGPPRKRVKMS
Download sequence
Identical sequences A0A0R3NH15 A0A1W4V5V8
FBpp0100174 FBpp0290848 NP_650325.1.81976 XP_015037339.1.19638 XP_016034763.1.80810 XP_016960064.1.21709 XP_017001259.1.47939 XP_017046929.1.74164 XP_017084415.1.81094 XP_017091707.1.53830 FBpp0100174 FBpp0290848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]