SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110100 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110100
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 2.35e-28
Family Hypothetical protein c14orf129, hspc210 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110100   Gene: FBgn0034327   Transcript: FBtr0110803
Sequence length 119
Comment type=protein; loc=2R:complement(14191098..14191457); ID=FBpp0110100; name=CG14505-PB; parent=FBgn0034327,FBtr0110803; dbxref=FlyBase:FBpp0110100,FlyBase_Annotation_IDs:CG14505-PB,REFSEQ:NP_001036558,GB_protein:AAF57714,FlyMine:FBpp0110100,modMine:FBpp0110100; MD5=e91f41a12a82f5311909f9bc9bd97554; length=119; release=r5.30; species=Dmel;
Sequence
MALVQSDENDFHALREAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQL
SRAGYRIVSYEFDDVADEVANCDTVYESAHQLLAGISPLYGEKYGFGREPLGKRKEKQS
Download sequence
Identical sequences A0A0B4K841 Q9V8F3
FBpp0110100 FBpp0110100 NP_001036558.1.81976 NP_001246404.1.81976 FBpp0110100 FBpp0298015 7227.FBpp0110100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]