SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110159 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110159
Domain Number 1 Region: 171-258
Classification Level Classification E-value
Superfamily TPR-like 0.000059
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110159   Gene: FBgn0051524   Transcript: FBtr0110860
Sequence length 535
Comment type=protein; loc=3R:complement(26338118..26338224,26338286..26338451,26338513..26339162,26339222..26339421,26339476..26339626,26339682..26339821,26339875..26340068); ID=FBpp0110159; name=CG31524-PB; parent=FBgn0051524,FBtr0110860; dbxref=FlyBase:FBpp0110159,FlyBase_Annotation_IDs:CG31524-PB,REFSEQ:NP_001036777,GB_protein:ABI31221,FlyMine:FBpp0110159,modMine:FBpp0110159; MD5=4c569461cd9d6f261778f28f2ac1a260; length=535; release=r5.30; species=Dmel;
Sequence
MPVLKLLFVVIFFLSLSMGQIEATQPRFARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKA
NTIRWGIQQMREQLDKSKKEQSFDLFNRYSFIRHMQADWLMWKQYLDKPVIHELNYKQMD
NLRMPQELDLFDASEAIRRMQATYAMLSNDIAEGFLDGVQYTSKLSPIDCLAMGRHLMNQ
SRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGALKAYQA
ALKHSPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLNR
LYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVNA
ANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESH
FDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHTE
GMLHVRTMHTGCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLDSKYLSSIEKIII
Download sequence
Identical sequences Q0KHY6
NP_001036777.1.81976 FBpp0110159 FBpp0110159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]