The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0110307 |
| Domain Number 1 |
Region: 1044-1251 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Concanavalin A-like lectins/glucanases |
1.31e-26 |
| Family |
Laminin G-like module |
0.016 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 1265-1432 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Concanavalin A-like lectins/glucanases |
1.8e-16 |
| Family |
Laminin G-like module |
0.015 |
| Further Details: |
|
| |
| Domain Number 3 |
Region: 1525-1548,1617-1772 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Concanavalin A-like lectins/glucanases |
0.00000000000113 |
| Family |
Laminin G-like module |
0.042 |
| Further Details: |
|
| |
| Domain Number 4 |
Region: 90-253 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Concanavalin A-like lectins/glucanases |
0.00000000000274 |
| Family |
Laminin G-like module |
0.019 |
| Further Details: |
|
| |
| Domain Number 5 |
Region: 728-770 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000000000147 |
| Family |
EGF-type module |
0.0033 |
| Further Details: |
|
| |
| Domain Number 6 |
Region: 843-885 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000000000155 |
| Family |
EGF-type module |
0.01 |
| Further Details: |
|
| |
| Domain Number 7 |
Region: 1875-1912 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000000456 |
| Family |
EGF-type module |
0.0096 |
| Further Details: |
|
| |
| Domain Number 8 |
Region: 425-462 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000000693 |
| Family |
EGF-type module |
0.0056 |
| Further Details: |
|
| |
| Domain Number 9 |
Region: 1836-1879 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000000694 |
| Family |
EGF-type module |
0.0056 |
| Further Details: |
|
| |
| Domain Number 10 |
Region: 766-808 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000001 |
| Family |
EGF-type module |
0.0074 |
| Further Details: |
|
| |
| Domain Number 11 |
Region: 945-988 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000000134 |
| Family |
EGF-type module |
0.0048 |
| Further Details: |
|
| |
| Domain Number 12 |
Region: 1993-2037 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000000162 |
| Family |
EGF-type module |
0.0037 |
| Further Details: |
|
| |
| Domain Number 13 |
Region: 804-847 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000000365 |
| Family |
EGF-type module |
0.0049 |
| Further Details: |
|
| |
| Domain Number 14 |
Region: 386-430 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000000513 |
| Family |
EGF-type module |
0.0034 |
| Further Details: |
|
| |
| Domain Number 15 |
Region: 349-385 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000000309 |
| Family |
EGF-type module |
0.025 |
| Further Details: |
|
| |
| Domain Number 16 |
Region: 651-698 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000000645 |
| Family |
EGF-type module |
0.011 |
| Further Details: |
|
| |
| Domain Number 17 |
Region: 465-499 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000111 |
| Family |
EGF-type module |
0.0097 |
| Further Details: |
|
| |
| Domain Number 18 |
Region: 305-345 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000114 |
| Family |
EGF-type module |
0.0064 |
| Further Details: |
|
| |
| Domain Number 19 |
Region: 689-725 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000114 |
| Family |
EGF-type module |
0.0074 |
| Further Details: |
|
| |
| Domain Number 20 |
Region: 1916-1960 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000172 |
| Family |
EGF-type module |
0.0083 |
| Further Details: |
|
| |
| Domain Number 21 |
Region: 267-303 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000456 |
| Family |
EGF-type module |
0.024 |
| Further Details: |
|
| |
| Domain Number 22 |
Region: 1803-1842 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000474 |
| Family |
EGF-type module |
0.013 |
| Further Details: |
|
| |
| Domain Number 23 |
Region: 1956-1997 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000155 |
| Family |
EGF-type module |
0.016 |
| Further Details: |
|
| |
| Domain Number 24 |
Region: 2032-2070 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000803 |
| Family |
EGF-type module |
0.013 |
| Further Details: |
|
| |
| Domain Number 25 |
Region: 2072-2114 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000148 |
| Family |
EGF-type module |
0.01 |
| Further Details: |
|
| |
| Domain Number 26 |
Region: 983-1023 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.0000274 |
| Family |
EGF-type module |
0.0083 |
| Further Details: |
|
| |
| Domain Number 27 |
Region: 1526-1584 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Growth factor receptor domain |
0.0000675 |
| Family |
Growth factor receptor domain |
0.0084 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0110307 Gene: FBgn0259685 Transcript: FBtr0111008 |
| Sequence length |
2189 |
| Comment |
type=protein; loc=3R:join(20121349..20121586,20130923..20131267,20131613..20132605,20132735..20132863,20133918..20134450,20134747..20135291,20135352..20135457,20135523..20135717,20135783..20136554,20136620..20136802,20136870..20138630,20138699..20138823,20138885..20139298,20139371..20139601); ID=FBpp0110307; name=crb-PB; parent=FBgn0259685,FBtr0111008; dbxref=FlyBase:FBpp0110307,FlyBase_Annotation_IDs:CG6383-PB,REFSEQ:NP_001036751,GB_protein:ABI31202,FlyMine:FBpp0110307,modMine:FBpp0110307; MD5=fc46f98d0386e353a641a2af19c3cc01; length=2189; release=r5.30; species=Dmel; |
| Sequence |
MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAI
SVYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRG
GEILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEY
GNLYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTV
QNVVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
QKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGA
CVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGA
FCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDK
PIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDIL
DATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNG
GTCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQ
NGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKNEKGSYKCYCTPGF
TGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGST
CIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENC
ELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERS
NITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNC
NDGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSV
LLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTE
REEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGS
KLNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSY
LRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQSGCPRTEQCKPNPCHSN
GECTDLWHTFACHCPRPFFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDI
SMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQ
KLDNGYNHLIEVVRNQTLVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGAT
TEPGIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVSNGSLNLIVEMYSLNVTDVQ
VNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWNDYTCKCPNGYKGKNCQEI
EFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQERSPLAFFYFQEQQSDDIVSEASPKQTL
KPVIDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGE
WSRIYLRAHNSKLEGGWKGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQA
RGSTLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC
ILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFF
CQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCEN
EPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCK
CSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEG
DYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCE
CPEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGALLGTFLVMARNKRATRG
TYSPSAQEYCNPRLEMDNVLKPPPEERLI
|
| Download sequence |
 |
| Identical sequences |
7227.FBpp0110307 FBpp0110307 NP_001036751.1.81976 FBpp0110307 |
