SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110416 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110416
Domain Number 1 Region: 5-81,134-215
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000214
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 2 Region: 745-793
Classification Level Classification E-value
Superfamily RING/U-box 0.0000707
Family RING finger domain, C3HC4 0.054
Further Details:      
 
Weak hits

Sequence:  FBpp0110416
Domain Number - Region: 476-693
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family Clathrin heavy chain proximal leg segment 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110416   Gene: FBgn0002566   Transcript: FBtr0111124
Sequence length 804
Comment type=protein; loc=2L:join(22817795..22817839,22817892..22818062,22818113..22818230,22818298..22818651,22820170..22820497,22831506..22831574,22831636..22832037,22832086..22832272,22832327..22832566,22832619..22832745,22832805..22833178); ID=FBpp0110416; name=lt-PB; parent=FBgn0002566,FBtr0111124; dbxref=FlyBase_Annotation_IDs:CG18028-PB,GB_protein:EAA46035.1,FlyBase:FBpp0110416,REFSEQ:NP_001036415,GB_protein:EAA46035,FlyMine:FBpp0110416,modMine:FBpp0110416; MD5=a6b40ec6522e1ba2fff4ccb27d1addba; length=804; release=r5.30; species=Dmel;
Sequence
MLNADVITCSAVHLKFLIFGTFRGRVCIFDHQGNSVYSNLSASERHTHQVAVNNIDVDHK
GEYVATCSDDGKVNITGLFSSDNNHSLSFGKFIKVVSLEPDSKAHIKRFVVGDDKLILYE
RNLLKKLKPVELCSVEGSVLSICWHGNFIAWASHIGVRVYDLNERCSLGLIKWEVPPQER
LENFRCHLRWSNKHTLLIGWVDTIRVCVIRKRNSIEASTGNLPVYIVDPISTFQTTFYVC
GLAPLSAKQLVVLGFRKEKSSCFKALRPVLCVIEYKMNNSEEICTDSLTLRGFEEYTVND
YSLGGIIEENRFYIVAPKDIVVASLIETDDRIEWLIKHSKFEEAMELISANGGNVPVLSV
AKLYINHLLALKKYDDAAKLCLRMLGNDKVLWEEEVFKFVKCQQLRSVSAYLPTSDECKL
DPHVYEMVLYEFLKFDVCGFLNLIKEWPSHLYDGLAVINAIHDNFRKHYANQLLESLALL
YSYQGDFESALRMYLKLQNKDVFQLIRRYELYDVISKLIIPLIQLDRDCAFEILLDKKKI
KTEIVVHQLEHNQEYLYWYLDSLLKKDPSNVFQKKLISLYAIFDRNKLLPFLKRSKDYDI
QEALVICKQENFYPEIVYLLGCMGGVEASEALNIIIHRIRDIEMAIEFCKEHDDSDLWNA
LINEFSKHPEIVTKVLDGIVDYFSPAVVVGKIKMGQNIPNLRQSLIKMLRHYNLQGEILS
SAQQIQLNDYFEIHSEIVTTQRRGQQVSYEQLCSLCHRPVLMAGTHLYCIIRLECGHVYH
KPCIQGELLKNCNECNLWKLTVGK
Download sequence
Identical sequences FBpp0110416 FBpp0110416 FBpp0305698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]