SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110511 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110511
Domain Number 1 Region: 214-577
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.72e-85
Family beta-glycanases 0.00000192
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.07e-18
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0039
Further Details:      
 
Domain Number 3 Region: 95-217
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000446
Family beta-Galactosidase/glucuronidase domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110511   Gene: FBgn0037215   Transcript: FBtr0111225
Sequence length 778
Comment type=protein; loc=3R:join(24088..24494,24552..24648,24727..25015,27565..28044,28098..28519,29504..29884,29935..30195); ID=FBpp0110511; name=CG12582-PB; parent=FBgn0037215,FBtr0111225; dbxref=FlyBase_Annotation_IDs:CG12582-PB,FlyBase:FBpp0110511,REFSEQ:NP_730783,GB_protein:AAF52171,FlyMine:FBpp0110511,modMine:FBpp0110511; MD5=a5a4adfc0edaefa1983e4077dd3f3591; length=778; release=r5.30; species=Dmel;
Sequence
MFVRYSYEVSSLLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMN
MLRKMQASFSWDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSYWNMHIRCFLD
AGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGKVVTWWPNGYG
EQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNG
VEMFMKGSNYIPSHLLPEMQTNEQISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSL
GLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWY
GTLFERDRFESEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPDNYISSNPQDN
QNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDLLGLITHRQHH
PLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMATKVETELYRSLRDTPHRTMG
ALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICDQL
EVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTNAFLE
LQLRRGQDVISRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNSVSISIQVKRP
AVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRVLTVNDFMR
Download sequence
Identical sequences Q0KIE6
NP_001262241.1.81976 NP_730783.3.81976 FBpp0110511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]