SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111321 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111321
Domain Number 1 Region: 11-139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000291
Family APC10-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111321   Gene: FBgn0085242   Transcript: FBtr0112406
Sequence length 139
Comment type=protein; loc=2R:complement(19854692..19854985,19855039..19855129,19855181..19855215); ID=FBpp0111321; name=CG34213-PA; parent=FBgn0085242,FBtr0112406; dbxref=FlyBase:FBpp0111321,FlyBase_Annotation_IDs:CG34213-PA,REFSEQ:NP_001097439,GB_protein:ABV53899,REFSEQ:NP_001097439,GB_protein:ABV53899,FlyMine:FBpp0111321,modMine:FBpp0111321; MD5=e8608dc1f744393b3d92a3b37a0cac0e; length=139; release=r5.30; species=Dmel;
Sequence
MNILTKVKYSCRVSSVLNRDVKQHGKQFMFDTREETSWNSDEGTPQFITISLEEPQKVAG
FSFQFQGGFSGQKSELIMYSADGAQVHQEPFYPEDINSPQLFQIAESVRENPCSKLKFVF
ESSTDLFGRIIVYDLQLFG
Download sequence
Identical sequences A2VEK1
7227.FBpp0111321 FBpp0111321 FBpp0111321 FBpp0111321 NP_001097439.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]