SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111529 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111529
Domain Number 1 Region: 77-237
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111529   Gene: FBgn0085409   Transcript: FBtr0112617
Sequence length 772
Comment type=protein; loc=2L:join(6190471..6190696,6192754..6192859,6196544..6196775,6196849..6196996,6201262..6201441,6203179..6203318,6203411..6203618,6206210..6206425,6206635..6206867,6207537..6207675,6207893..6208383); ID=FBpp0111529; name=CG34380-PC; parent=FBgn0085409,FBtr0112617; dbxref=FlyBase:FBpp0111529,FlyBase_Annotation_IDs:CG34380-PC,REFSEQ:NP_001097097,GB_protein:ABV53631,FlyMine:FBpp0111529,modMine:FBpp0111529; MD5=1c62e2fb1fbbc32a93ba45916e71a279; length=772; release=r5.30; species=Dmel;
Sequence
MKHTSPSEATFSSNISMFSRQCLSHLTRSPPTTTPTAAAPRPPCRAPRWTLCLWTLVIAS
GCLMLNAPTTMAFDIATCNVPLGMESLLITDAQITASSAHDMAFVGPQHARLKTDNDGGA
WCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQR
WKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGI
VSYSIPKGVQRGMEVDLSDKTYDGNEQGDRYVDGLGQLVDGQKGKDNFRTDIHGFGKGYE
WIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYF
SGEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPAMGNF
TDEQEQRSNSPSQAQDVHDETNGSEYQANRNKPNGVGGSAGGLGEGVAAAGGDIVGNNKY
NNGPQLIAPRPIDQEPNDANFIGVVIVVLTTIIILLVAIILFIVSRTKRARGSNVLDAFQ
YSFNPNTLGGNVDKHRPNGNSIKANVDDNDSIGKNSLYHEPFNVNMYTCGVNGYAAVNDL
QCNMTPDYTDVPEGGYAVPHMQDYMPSSKMGGGAPGGGGYVNVRRTPPPPLSSIFPRPPT
VPPPPMEKYYATTAIFKPLKGPGSERSGCSSNTNTVSSGGGKSSHSHSSHCSTGGPDHSG
IYDDGIGTMNSKATAPMINPYSSGNSSSAAAAAAAEFQRARTYNFRSYPDNL
Download sequence
Identical sequences A8DYR2
7227.FBpp0111529 FBpp0111529 FBpp0303015 FBpp0111529 FBpp0111529 NP_001097097.1.81976 NP_001260124.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]