SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111634 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111634
Domain Number 1 Region: 290-396
Classification Level Classification E-value
Superfamily ARID-like 1.57e-30
Family ARID domain 0.00034
Further Details:      
 
Domain Number 2 Region: 510-601
Classification Level Classification E-value
Superfamily Chromo domain-like 4.58e-16
Family Chromo barrel domain 0.024
Further Details:      
 
Domain Number 3 Region: 63-116
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000183
Family Tudor domain 0.031
Further Details:      
 
Weak hits

Sequence:  FBpp0111634
Domain Number - Region: 192-258
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0221
Family PWWP domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111634   Gene: FBgn0085451   Transcript: FBtr0112722
Sequence length 2307
Comment type=protein; loc=X:join(18738065..18738070,18738529..18739855,18743913..18749084,18749160..18749387,18749452..18749642); ID=FBpp0111634; name=CG34422-PA; parent=FBgn0085451,FBtr0112722; dbxref=GB_protein:AAF48893.2,GB_protein:AAF48895,FlyBase:FBpp0074413,GB_protein:AAF48895.2,FlyBase:FBpp0111634,FlyBase:FBpp0074412,FlyBase_Annotation_IDs:CG34422-PA,GB_protein:AAF48893,FlyBase_Annotation_IDs:CG7274-PA,FlyBase_Annotation_IDs:CG7282-PA,REFSEQ:NP_573330,GB_protein:AAF48893,FlyMine:FBpp0111634,modMine:FBpp0111634; MD5=30cd2532f44ab1b5855396d561975447; length=2307; release=r5.30; species=Dmel;
Sequence
MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPT
GQLRVGAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNE
SETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVNEKEENIGKVVC
VETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREV
ASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRF
VAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFT
PCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPME
TMKTETISKLAQPNQTNVVASTSSIAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADK
EKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKV
IEISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGG
GGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLG
GASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQ
QMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGR
LASSASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGA
ASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESS
AKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKE
EPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYT
SVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKV
EMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQPS
NVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFKDTEPFEFEKRISPMASVG
GTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSAPVVVGSAARKQALKAS
AIQHILEHQSPAAGRERGGYGGMTSSISLLTAPKLKKRGSPLKEAALCMEKAKTYKLDKD
QVQQPVEQKTQQLIQPTLGPVESYGAGSPEAMSNLSTPTTSSGHAQLSASSTYSQLTPHH
ATPFDALRKSPSFNLNITALNEELAQTVQETTRALTDALQPPSTPVPPTVSASGSTPTAV
TPVITAMPTAGTAGLSCPSTPPTGANPVLASPKLSTPPQAINASKQPPASHIVGSPFIET
RNVFELSTSNEGSGYSSGESKDNKFEKLENVKILLAGAVGPFDLDAGSYEQKTSSIADKV
LKAISQKKEEVENNKGKPPVEPAAAAKTPGREDVVPSPTAKLDLCSSAIKLDTLKLLSEP
LKIQTGPLLGELYRPGPATSSPETKSILESSLPAKNSELSETIQKLECAIQQRKTPVGGA
LSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSEQRLVIEDVIAEEHTTTTTTGEQ
KSPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKLELGAKAMPGIQAPIPLK
PAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQGQSKSISSFGIPIVLPEIPASVVVATP
ALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEVGGLLLKAYTGVSGAVGAAP
AGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAEPSNSSAPVVARP
FVMHAVGKELFNVVAPAASSPLISDPHNESINLLCEETIPGSPAPNYGGTDQLPTAVNSA
LAIVGITPLPPDTPPPVPVAAIQQQQQHQLQSGQQQQAAKTGEVNPSGPNSSPDSASQDE
SGEEAKKNAGLEHEDSTGLGALNKRKRNRKPLPMSAQTAAAVAAQLQSLGKRRRQVSGMR
NQKTTTTAAGSDTDDNSDNIAPNAGQQQQQPRQSARQHMMPQSNAQQQQQQQLLQQQQTQ
LPQGIQSTNSSGVRPCPYNFLVELDPALSSDECITILRKQIQDLRKAYNTIKGELAVIDR
RRKKLRRREREKKQQQLQSQQQGKICA
Download sequence
Identical sequences FBpp0111635 7227.FBpp0111634 FBpp0111634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]