SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111635 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111635
Domain Number 1 Region: 290-396
Classification Level Classification E-value
Superfamily ARID-like 2.88e-31
Family ARID domain 0.00034
Further Details:      
 
Domain Number 2 Region: 63-116
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000361
Family Tudor domain 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0111635
Domain Number - Region: 192-258
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00206
Family PWWP domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111635   Gene: FBgn0085451   Transcript: FBtr0112723
Sequence length 625
Comment type=protein; loc=X:join(18738065..18738070,18738529..18740400); ID=FBpp0111635; name=CG34422-PB; parent=FBgn0085451,FBtr0112723; dbxref=FlyBase:FBpp0111635,FlyBase_Annotation_IDs:CG34422-PB,REFSEQ:NP_001097025,GB_protein:ABW09452,FlyMine:FBpp0111635,modMine:FBpp0111635; MD5=50d44f4d45b2ce0b2437fc9b343c1115; length=625; release=r5.30; species=Dmel;
Sequence
MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPT
GQLRVGAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNE
SETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVNEKEENIGKVVC
VETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREV
ASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRF
VAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFT
PCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPME
TMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSV
VVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSA
AASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSG
SSASASSKANSAEMQRSRDASPSGK
Download sequence
Identical sequences FBpp0111635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]