SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111723 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111723
Domain Number 1 Region: 3427-3634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-36
Family Laminin G-like module 0.00046
Further Details:      
 
Domain Number 2 Region: 3936-4144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-28
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 3681-3884
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-27
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 2775-2861
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 2681-2764
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000092
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 2866-2950
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 1262-1344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000054
Family I set domains 0.061
Further Details:      
 
Domain Number 8 Region: 2583-2658
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000552
Family I set domains 0.043
Further Details:      
 
Domain Number 9 Region: 2391-2484
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000001
Family I set domains 0.035
Further Details:      
 
Domain Number 10 Region: 1226-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 2486-2576
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000637
Family I set domains 0.014
Further Details:      
 
Domain Number 12 Region: 3076-3183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000138
Family I set domains 0.032
Further Details:      
 
Domain Number 13 Region: 1047-1132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000371
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 3285-3365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000172
Family I set domains 0.035
Further Details:      
 
Domain Number 15 Region: 1183-1218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 16 Region: 3163-3257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000463
Family I set domains 0.068
Further Details:      
 
Domain Number 17 Region: 919-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 486-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 3361-3442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000849
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 201-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 289-331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 22 Region: 984-1023
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 23 Region: 840-877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 24 Region: 1140-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 715-751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 26 Region: 880-914
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 27 Region: 618-654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 28 Region: 3622-3664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 536-576
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 30 Region: 32-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 31 Region: 74-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 436-474
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 33 Region: 117-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 804-838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 35 Region: 657-694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 1990-2039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 37 Region: 765-801
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 38 Region: 1647-1695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000264
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 39 Region: 401-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 40 Region: 582-617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000851
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 1953-1992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000872
Family EGF-type module 0.076
Further Details:      
 
Domain Number 42 Region: 2990-3056
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000235
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0111723
Domain Number - Region: 157-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00038
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 2300-2337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 1583-1611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 1707-1749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 2072-2109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111723   Gene: FBgn0261451   Transcript: FBtr0112811
Sequence length 4156
Comment type=protein; loc=X:complement(2365185..2365227,2366985..2367132,2367208..2367624,2367693..2368393,2368463..2369388,2369449..2369721,2369857..2370062,2374767..2374941,2375103..2375352,2375450..2375909,2376030..2376424,2376492..2376669,2377157..2377419,2377519..2378122,2378366..2378546,2378650..2378792,2380960..2382046,2382114..2384350,2384489..2384875,2385352..2385445,2385514..2385647,2386379..2386453,2386688..2386918,2387021..2387248,2387584..2387709,2388437..2388670,2389074..2389271,2389645..2389761,2389981..2390066,2390494..2390626,2390809..2390958,2391351..2391521,2392055..2392148,2392516..2392664,2393244..2393711,2394270..2394395,2394596..2394709,2394804..2394935,2395152..2395274,2395660..2395770,2407676..2407778); ID=FBpp0111723; name=trol-PG; parent=FBgn0261451,FBtr0112811; dbxref=FlyBase:FBpp0111723,FlyBase_Annotation_IDs:CG33950-PG,REFSEQ:NP_001096869,GB_protein:ABW09330,FlyMine:FBpp0111723,modMine:FBpp0111723; MD5=7cde74fb7a6f4a4b163d2e96b9fea1f3; length=4156; release=r5.30; species=Dmel;
Sequence
MGRRLRAAFWLLAVLIVIEKPQKSVARGTYLSYGECQANEFRCNNGDCIDARKRCNNVSD
CSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYT
CPKGKFTCRDLSCISIVHRCDGRADCPNDRSDEEGCPCLYDKWQCDDGTCIAKELLCNGN
IDCPEDISDERYCEGGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNCVEGE
EEDRVGIPIGHQPWRPASKHDDWLHEMDTSEYQVYQPSNVYEKANSQNPCASNQFRCTTS
NVCIPLHLRCDGFYHCNDMSDEKSCEQYQRHTTTRRPLTLATPTSRITTQGPGLLERRNT
TTATEASRWPWATKTTTIATTTSNPITTVGVANSPPQTCLENIEFACHNRDCISIESVCD
GIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLN
KTRLGVKCLESQYQCGDGSCISGYKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLN
ECDILEFECDYSQCLPLEKKCDGYADCEDMSDELECQSYTDHCLESEFECDSYCLPRDQL
CNGIPNCQDGSDERNCTFCREDAYLCNTGECVADNQRCNGIADCADGSDERHCARIYCPP
NKLACNGTCVSRRIKCDGIRDCLDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCR
PHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCY
NRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANCTAI
LCKDNEFLCFDRQFCINATQQCDGYYDCRDFSDEQNCIGCYANQFRCNNGDCVSGSAPCN
GYSECSDHSDELNCGGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTE
VSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDE
ADCGQISNDIDPADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPG
GRPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVTVNLNVERYNDVGSRP
ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCSNSKCVDRT
WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVG
CMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGGTGTL
RCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQC
FCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFR
ATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRGSGRPVNGPDVIITGNRFTLT
YRVRTQPGQNNRVSIPFVPGGWQKPDGRKASREEIMMILANVDNILIRLGYLDSTAREVD
LINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCESCASGYVRQPGGPWLGHCVPFIP
DSCPSGTYGDPRRGVPCKECPCPLTGSNNFASGCQQSPDGDVVCRCNEGYTGRRCEQCAA
GYQGNPLAAGGICRRIPDTSCNVDGTYSVHSNGTCQCKDSVIGEQCDTCKSKSFHLNSFT
YTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAE
PNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTLSYSPLPNGIMSRNSAPDVV
IKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIK
ATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEG
GIYLGLCRPCECNGHSKYCNSDTGDCEECSDNTEGPSCERCAAGYVGDATRGTIYDCQPD
EGYPIPSPPAPGNQTLECTAYCQIEGIYDCRGNECLCKRNVIGDQCDQCRPGTYGLSAQN
QDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLITDESGAVQDTENLIPDISRNMYT
YTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIWSR
PDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTS
IGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCESCAPLHYRDASGSCSLCPCDVS
NTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQIIVSIQKPEITIVP
VGGSMTLSCSGRMRWSNSPVIVNWYKENSRLPENVEVQGGNLYLYDLQVSDSGVYICQAV
NNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAPRVTWAR
VDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQ
DRLYITPEEINGLAGESFQLNCQFTSVASLRYDWSHNGRSLSSSPARNVEIRGNTLEVRD
ASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYS
ITCEASGSPYPSIKWAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSS
TSIDIEPRERPSVKIVSAPLQTFSVGAPASLYCTVEGIPDPTVEWVRVDGQPLSPRHKIQ
SPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDEL
SLTCVGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSD
EAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTC
DMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKE
LVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDVHWSTDNNRPLPSSVRIVGSVL
RFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCT
VTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQ
QLPEVSIDLQVLTATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSD
DTYTDVVWERSDGAPLSNNVRQVGNRLVISNVSPSDAGNYVCKCKTDEGDLYTTSYKLEV
EDQPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSV
QANDAGTYICTAQYADGETADFPNILVVTGAIPQFRQEPRSYMSFPTLPNSSFKFNFELT
FRPENGDGLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPMLVRAEEPLALNEWHTVR
VSRFKRDGYIQVDEQHPVAFPTLQQIPQLDLIEDLYIGGVPNWELLPADAVSQQVGFVGC
ISRLTLQGRTVELIREAKYKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCICQPGWTGR
DCAIEGTQCTPGVCGAGRCENTENDMECLCPLNRSGDRCQYNEILNEHSLNFKGNSFAAY
GTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPV
VVRSAEPLPLNRWTRIEIRRRLGEGILRVGDGPERKAKAPGSDRILSLKTHLYVGGYDRS
TVKVNRDVNITKGFDGCISRLYNFQKPVNLLADIKDAANIQSCGETNMIGGDEDSDNEPP
VPPPTPDVHENELQPYAMAPCASDPCENGGSCSEQEDVAVCSCPFGFSGKHCQEHLQLGF
NASFRGDGYVELNRSHFQPALEQSYTSMGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAA
AVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAILEVDRMLHSGETRPT
SKKSMKLPGNVFVGGAPDLEVFTGFRYKHNLNGCIVVVEGETVGQINLSSAAVNGVNANV
CPANDDPLGGTEPPVV
Download sequence
Identical sequences FBpp0111723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]