SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111755 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111755
Domain Number 1 Region: 1438-1699
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-21
Family YWTD domain 0.017
Further Details:      
 
Domain Number 2 Region: 1130-1220
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000589
Family Pre-dockerin domain 0.047
Further Details:      
 
Weak hits

Sequence:  FBpp0111755
Domain Number - Region: 880-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 849-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 813-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 979-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 784-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 2485-2599
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.051
Family Cell wall binding repeat 0.016
Further Details:      
 
Domain Number - Region: 949-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111755   Gene: FBgn0004449   Transcript: FBtr0112842
Sequence length 2997
Comment type=protein; loc=3L:complement(22288688..22290979,22291089..22294416,22295895..22296102,22296163..22296708,22296799..22297210,22297346..22297629,22298067..22298864,22300647..22301291,22333562..22333741,22399992..22400292); ID=FBpp0111755; name=Ten-m-PC; parent=FBgn0004449,FBtr0112842; dbxref=FlyBase:FBpp0111755,FlyBase_Annotation_IDs:CG5723-PC,REFSEQ:NP_001097661,GB_protein:ABW08579,FlyMine:FBpp0111755,modMine:FBpp0111755; MD5=005e24395b8bba241e4870a3c5746d76; length=2997; release=r5.30; species=Dmel;
Sequence
MNPYEYESTLDCRDVGGGPTPAHAHPHAQGRTLPMSGHGRPTTDLGPVHGSQTLQHQNQQ
NLQAAQAAAQSSHYDYEYQHLAHRPPDTANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNP
TMSRMQNGRLTVNNPNDADFEPSCLVRTPSGNVYIPSGNLNINKGSPIDFKSGSACSTPT
KDTLKGYERSTQGCMGPVLPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVL
FAFVVMLILLTTTGVIKWNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQG
IGLAQGQSGLGAAGVGSGGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSS
LTPSLSSSLANANNGGKVSQQTGKASLQSLQSESDLMMNDASHYEDIDIVKLDGLTISHE
EEIYKTADKENMAPKNQPSQHIDRSQNEVLKGHQQGDEKQPQLEPLKPYVSERVDLPGKR
IFLNLTIATDEGSDSVYTLHVEVPTGGGPHFIKEVLTHEKPTAQADSCVPEPPPRMPDCP
CSCLPPPAPIYLDDTVDIDSAPPAKTVTTSTISAPINPFHSEEEDDEDGVRDEEQTPSSS
TATNLPSTEIDNHIAAFTEPAVGAGGVPFACPDVMPVLILEGARTFPARSFPPDGTTFGQ
ITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFKE
VLSGFSASTRTARAAHLSITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAEDMTQNC
PNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLR
HDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKG
PDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA
CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRV
SGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVS
APKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNESRSAVIRGRVVTSLGM
GLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVI
IDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGACPDRSAILAESQVIQ
ESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEAD
PGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGG
WNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPDCDGQATKQRLL
APVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSD
PESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAIS
SDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVS
PMDNTLHIIDDHMILRMTPDGRVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGP
LGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNT
IAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVST
RNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMT
RMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIE
LSFDLSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESRTTVDMDGSTTSITPWGHNL
QMEVAPYTILAEQSPLLGESYPVPAKQRTEIAGDLANRFEWRYFVRRQQPLQAGKQSKGP
PRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGD
YADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKV
TTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDE
GQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRR
EFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNL
GQLEVVQDLKITRNAFNRTVIQDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYD
LRNRIKSQKTTFGRSTAFDKINYNADGHVVEVLGTNNWKYLFDENGNTVGVVDQGEKFNL
GYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRS
RLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYV
ATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQ
RQYDPHVGQWMTPLWETLATEMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGY
DLNNMQSSRYTKLAQYTPQASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLK
MEPKMRNLLPRVSYRRGVFGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDL
HFSIHDQDVFYFVKDNVLKLRDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAV
VIIKYGVDPEQERHRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDV
DGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRKRRKTGSSHRSASNRRQLKFGELSA
Download sequence
Identical sequences FBpp0111755 7227.FBpp0111755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]