SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111849 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111849
Domain Number 1 Region: 624-716,835-946
Classification Level Classification E-value
Superfamily TPR-like 1.92e-35
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 737-862
Classification Level Classification E-value
Superfamily TPR-like 2.84e-18
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111849   Gene: FBgn0028481   Transcript: FBtr0112936
Sequence length 960
Comment type=protein; loc=2L:join(930335..930423,943435..943500,950492..950578,951587..952142,952256..953333,953396..953510,956249..956334,956404..956792,956860..956944,957052..957209,957279..957452); ID=FBpp0111849; name=CG4341-PB; parent=FBgn0028481,FBtr0112936; dbxref=FlyBase:FBpp0111849,FlyBase_Annotation_IDs:CG4341-PB,REFSEQ:NP_001097048,GB_protein:ABV53597,FlyMine:FBpp0111849,modMine:FBpp0111849; MD5=7671aeb26a58d70b1799130593c7f0f6; length=960; release=r5.30; species=Dmel;
Sequence
MPSLEPWLWGDSCSWLGMLAMLRLRLHKSKTLKVRSGKNPFLADVESAVSLHMDFTCLFC
CSLAFVLYLNTLGAGFVYDDRRAILANADVSGGTPWQRSFSNDFWGTPLTDSGSHGSWRP
LCVLSFRLNYLIGGGFAPWGFHLVNNLLHCVATALVVRVARTLLASVWAVLAAGALFAAH
PIHTEAVAGVVGRADLAACVCYLLTYLSYLRHMRWRESGDPRQWLALGATLILAAAGLLC
KETAITALLVCALFDVMRGLSGQVDKQRLRSVCIVLGALFCMAYCRLVIVPGPQTAFSSA
DNPIARTPSAWTRLLTFLYLPVFNLRLLLQPNVLSFDWGMDALPRVTSLWDRRNAQSACF
YSVLVGVAWGSCRQLLSGSKEVTHCGVSSTFPQYHIQKVASRKSRSKRKRLANNTKYQAF
EAAYHQQQQEALPCRDCNNNNSSGYVYEGSSPVAQAPAQAPHLVSSAFRGSRSSSSCSNS
TNSSSSSSSSSSSSSSSSSSLSGGFQCSSKDYALEGMSPANRHACVLIMSLSFLALPFLP
ASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLR
TLRRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADV
HFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSN
LDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQR
IGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLA
PEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMW
YRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASYKAALRLQPGDAITLGNLAKLGVTNV
Download sequence
Identical sequences 7227.FBpp0111849 FBpp0111849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]