SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111865 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111865
Domain Number 1 Region: 98-276,331-387,757-795,827-871,1003-1040,1111-1240,1322-1342,1395-1443
Classification Level Classification E-value
Superfamily ARM repeat 0.000000633
Family HEAT repeat 0.085
Further Details:      
 
Domain Number 2 Region: 605-707
Classification Level Classification E-value
Superfamily Sec7 domain 0.000068
Family Sec7 domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111865   Gene: FBgn0029834   Transcript: FBtr0112952
Sequence length 2070
Comment type=protein; loc=X:join(5934735..5934819,5935619..5935752,5936287..5937305,5937369..5938647,5938718..5939085,5939149..5939584,5939652..5942543); ID=FBpp0111865; name=CG5937-PB; parent=FBgn0029834,FBtr0112952; dbxref=FlyBase:FBpp0111865,FlyBase_Annotation_IDs:CG5937-PB,REFSEQ:NP_001096888,GB_protein:ABW09341,FlyMine:FBpp0111865,modMine:FBpp0111865; MD5=63f68a639e66b59ab7c72a78e0d84495; length=2070; release=r5.30; species=Dmel;
Sequence
MEDLFLLIIKESTGTKHNALRQTAQIAYDKLYRQHGIHRDPSHELRSVCFTALQMALDTK
RPKFITMGLNGLHRVIKDERFYIGLEPEDDSVWLPSQLLRATNGILPTTSSEDTVVNVLR
LFLAMACSPACTLNGRLLIEILSRCGECWEMGSRATKAASLAAASQCLRTFCAFLIEEAE
EVKKTAPAGLMTQTQASAVYNEVIPVMQWLCSRLVEPNVNASPNKKCENHSSLYLTECIL
TLSSALPRNVHANPHFTSFLWQKFCPTLAAALGSPGRINLDKKFTYKLVKGNKNKNIESP
NIHYLRDALHMIENEARGFFTGPGLDGPQARCVYLTAIQLLRIAGAHGSLRPMLEALFHR
MLLLPAPQNRTEPLRCVREIFKSPERLIDLAVILYVDKNTAQGCSDEMALFRLLVDAMEE
CAYGASGGGSATEASLQASVECMVALLDSLQVLCSGELTESMISDQIVQVVNGRHDLLKD
ADYSGPLTYQSMARLPAPYRDAIVEFRQTVFETSSGSESEGEPQHEQDAASNGSGDTEGP
EDDDPSSSSDETSRVENRWPYSHLEAPVMPIRTDSDNDRQHARDFARALRQDLVPKLLRL
RSCVELDEAMQEFASAVCQENSMNFSDFDYNLTAINADGIYLAIYSSLLLSLQLMRAGFY
EQVAQGMSHKDILVPMSEQQFVTSVQNTGVLVYLSSPWLCELYQSVTVCNVLEAMPRQQL
EGMGPRCALVDMLCDAGGLGATQMLSEWQRLQTANVKHKEEEQLHDKRREAAKKLCRRLL
TCCWDSMVIVLSSGLGDLQTSSASNKLVALSKRTLRVKAKANKSNGEALYAMCLDGLHSA
ATLSNSLNLQHLAGKILNLLASNVCQTSGPRISASQAMSMDVVLTGGLNLGSYSADCWPS
IFAVCRHVSQLEHEIFSMQNPAISASPGSSRRDLETGEKLSNGNAQDKLNLSSIPIDDDE
TCVDVYSFLQAPMQSPNTNITSILKVYSGTNETVLLSQSDTSKVLCALSHQAENLFGDAA
ERLSLPSLCQFLKHLCRASRDQLYKSQVARKGSRIWWPSKGWKKLDSLPMSLLLHRIGDV
TLKVFRSSRPLLHVLKVWAITGPHLMDAACHRDRMISKRAIEYIHDIITALLVEQSELPY
FHFNEALLKPFENLLSMDTDVDVQDQIVACLYEVVEAHRTEIRSGWRPLFGTLRNARSRM
LNMSNIIDIFRVFLDSDNTLVFANAGLDCILCLLSYLEISGGGNNNACSGGSGSAAGGTA
SNGGQQEEDNTFRPTDFLHETLRFLERCSSILGFMHSMPKCPNFHSTYKIKGISYTHIID
ANIPSSMENFTYFGNDYLQTRNEQYMISYRSLHIDKDTIVKIDEMDKPSGVLKVWFLLLD
GLTNSLIVCPYSHQAPILQTIFKLFKNLLASPGIDFGFYCINHLLVPMIQDWLRYINKTG
SSWQLVEKNFKHCCCMTTDLVVEFIEKSVPEQRRLGAGTKTRLAQIVHPADNLLYSKLKF
VTERIEREQQQQQSPSVQDHGCGYTQQYDSSSSSASEEQQKNGGGVGGGGSNLIESPTKI
SGSATLALKQLLLVLIECAAQSQEAIARISVSCLKHVILSTGMLFNESQWMIACSAIHRA
CTVTIAPLRQLSFAFHEKSNSFYGDCANVKVAARRDSSLEELARIYALAQQVFLSDNQRE
PGQNQAPTPSASQCKLSDDRSYSFLLYPLNNGFNSNLDNFVIRIPFKNLVVGLLANQMLL
QLVAKLLLSRLKCVPQAVSTCIFDNYAASAASPSHDYDLDFRSKEILLRCVKQYLMSALE
FDSRPGLKFLMQKVSNIEYAANLYKQMTSSWMIYYIALVDSHLNDIVVYNLGPEDLNFIL
ESCSRLNTTTVKKKENFVRYLFCLQDAWNLVCELYLSNSALHEIESGSGKLRQKPPQLLH
HPQTKPMCISLNGNGDAEMTDTGSGSGSGSSTSPSKCVQLQEEENVTMTTLISEFQPKCR
SNPFDTNRQAKSSEAESISPEIEQQRASSILKDSNYKRAALAQLVVASMELLRSLPGEAE
ENLKLLMTPTIREAFRLVQLQGNELKVNQF
Download sequence
Identical sequences FBpp0111865 7227.FBpp0111865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]