SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111903 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111903
Domain Number 1 Region: 209-314,366-634
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-136
Family Myotubularin-like phosphatases 0.000000146
Further Details:      
 
Domain Number 2 Region: 1152-1220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 48-134
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000167
Family GRAM domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111903   Gene: FBgn0030735   Transcript: FBtr0112990
Sequence length 1241
Comment type=protein; loc=X:join(16191706..16191817,16191882..16192873,16193053..16193243,16193309..16193504,16193573..16193758,16193828..16193992,16194064..16194190,16194259..16194364,16194431..16194741,16194804..16194908,16194972..16195557,16195634..16195784,16195846..16195950,16196243..16196445,16196940..16197129); ID=FBpp0111903; name=CG3632-PG; parent=FBgn0030735,FBtr0112990; dbxref=FlyBase:FBpp0111903,FlyBase_Annotation_IDs:CG3632-PG,REFSEQ:NP_001096998,GB_protein:ABW09429; MD5=99a04a579c28beaf04869ed95124d78e; length=1241; release=r5.30; species=Dmel;
Sequence
MSDGSPPPSICFIRAAESYPKSQMEKEDSQLFVPFQELAGESIKYLGRTDDGILALSNYR
IFLSKQSTGYETYVPLGLIESVQVRDLFQLIVNCKDASTVRCSFPSAEQCSDWQRRIHLM
IGVPESLETLFAFPFYSWTCDVLGSGNGSGIVSAQANGNGLIAKDRCLTLHNGLAKPTAN
VTASNPLPDPASETISAAMSNRLQRSVRYESDFKNEVARLGFDLKGSWRISTANADFKLC
PSYPPKLLVPCCITDEMLHNVANFRGSRRLPAVVWRHQKSGAILARCSQPEVGWLGWRNT
RDEQLLKALADACAFDRGEHARHSTCANAKAQPTKGSKETNGQSGLSGKSSPSLDDSSHE
ELTLDEIKKILIVDARSYTSAVTNRARGGGCECIEYYPCAEIEFMNLGNIHAIRKSFHAV
RQLCASSPDDPNWYGQLEKTMWMQHLSGLLGATMTVVHTIEKNGRPVLVHCSDGWDRTPQ
IVATAQLCLDPYYRTVEGFRVLVEREWLNFGHKFADRSGNGPNSDEVNERCPVFLQWLDL
VHQIHRQYPCSFEFSISYLIKLAQHSLSCLFGTFLCNSLRERIENSVFDRTFSVWPFLAE
TMYRNPLYKHETEKVLWPAHSVRFLYFWSDVYLGSLGNKNGTDLPLLSNERQSGHNGLMA
KTRSSEDLTTNELGQSTISRRSSDPNLTVESIVTDCFNANSNSMFDIRSEANNSVSENVQ
ESVKDSKEVELDVTDATEVGPCGRSNNPIPDFHNDQSTASKRDILEVESQTQRRSSLESS
QLIPGSVFIFGSSENDKNAVPSESEESLATSQKLNSESGRPFFIFGSSENDQSPVPLKSE
DTSDISRALWHGAIETSTDTLIPAEPVQKPNSDNSSRDHITSPTMELVSGDRKLESTSTV
QASKISQSYNNLPKVHIRPNAVICPQRVDAFPHHLDLQVPRETTGNPDRCKPEKLAKDAN
ANANANGSLLASDGYNGEESLFISPDLQRFVGQSPFDAPSTGGRIRRNTFGSSYSRDMKF
TAENGSAHQFPSSGIISLPPTPFQERAQFTISCPDGLAHGLSEQNIRLHQIVQEHKLREE
MLLREIHGMRLALLEKGCPSCNSIVSTNMEHENGSDIVENASTCSWEAVEERSGPASYAP
SSIQEKKASSVLWVPDHAVSRCSSCQTEFWLGRRKHHCRSCGEIFCADCSEFWAPLPNEK
LFNPVRLCGSCYTSVTTNVQEYAAVPAESQAKDDETSSAIS
Download sequence
Identical sequences A8JV04
FBpp0111902 FBpp0111903 FBpp0111904 FBpp0111902 FBpp0111903 FBpp0111904 NP_001096997.1.81976 NP_001096998.1.81976 NP_001096999.1.81976 NP_727950.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]