SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111945 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111945
Domain Number 1 Region: 71-169
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000605
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0111945
Domain Number - Region: 170-229
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00119
Family Hormone receptor domain 0.0065
Further Details:      
 
Domain Number - Region: 33-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00143
Family C1 set domains (antibody constant domain-like) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111945   Gene: FBgn0032180   Transcript: FBtr0113032
Sequence length 1460
Comment type=protein; loc=2L:complement(10064798..10065315,10065614..10066117,10066187..10066376,10068223..10068355,10068636..10069672,10073175..10073384,10074139..10074277,10074346..10074528,10075221..10075370,10075919..10076265,10080375..10080491,10081248..10081946,10086201..10086306,10087835..10087884); ID=FBpp0111945; name=CG31714-PB; parent=FBgn0032180,FBtr0113032; dbxref=FlyBase:FBpp0111945,FlyBase_Annotation_IDs:CG31714-PB,REFSEQ:NP_001097136,GB_protein:AAF52856,FlyMine:FBpp0111945,modMine:FBpp0111945; MD5=56aaa896f3d7e36fcd69358b0cb4fc50; length=1460; release=r5.30; species=Dmel;
Sequence
MCYCAKVDVNPAWAHLLEIWTTVLPPETKDVYTAILGVTKASRIDEGVYSCKVTDWGVEQ
CRSLHIHIKSPPRLRVDPASVTLQRGDSLRVRCLSPGNDDIKRYAQLGYSWTRNGVLFQS
DAATAMWEDLYPDGSILKINNIQKSAEYACLVSNSVRPVSRSVYINVIERNAVHVCPAES
TYGVHWPTSAPGSPIITDCPRGFEGHLKRICEQRDTGNSTWLLPDFSGCVRDELLLIYNR
FLALSAGFQQTNSSNILKACFEFTLQRRHSFLPGEASFLIDMLHELDTYLQLKGTQLERE
MAAEIILRILDKVMQNAQSLNSQQQIKKLQQLTQSAALNRETIAASQLATSTSGSSQPLP
GDSSTRGDDGSGSGVTAGEMSAAPAGSLQATRAGGAGGGPGGASSILTVDEDTLSLDRLN
SLRIYMTSVKTLPFNLRIYGEDLFSDQLYMDIGLSSRLLHIMANSTIFASVISYKNLKSF
LPKTYYTRGSDPRDSDYVLASRIIQTWLFQSNRSNDNFREPLDLPFEAGHVEIIFQHESV
PKKGDWVAVCGHDYKASFDSTWRSDLCITKHLMANITRCICPLSGTYVVMLTKRQPNATP
HNAPRRPIFVIASCACCLLQCGSALLILVPIWCNRKCAVTFLKMQFCVSTSSVMLIYLLG
FMKMLPVSWHGIISSSLASLLLLGISTLIAIALAIHTELMPKKYLQIGSKPATPTKRRLR
REQERERERERDRDRERDRELDSLSNITQIRAQSPLGATTASTTITTTTSSSNPGQRRPP
PSSTAGMRGAIGISWLLPLLFAVAAPLICSIIGQWPRHWWLEVLWTGSASPEAGAGKDEA
GDSDSGAFYSAHSLLNGDNLLLESEAVMGNGTSSPPTETSSASSSSSSTGRAVDDDVATS
TSSITSIGSASNSGFSASWSGITSFSTSTSTTSSTSTSVAALAAPLTSGPGDSSATPSPS
LSFILFVCIDLLFILLFFALFAILMKKLLWLWHKNRNVHTHPLDKFNLALSRRFGLLYRA
GGLLLAKICNDGLFIAYVNSSPDTLLAYPFGISCILLGSAILICFVIKAESQLRGPPFLS
SNGSSQNSSLKQAKFNTSRSSLDENYCTTTTTANVNSPLSFYTNHDKEKENDCAVSLSMS
NAGVSAAAVGSLASSAGVVGGAPPLQSKVGLDMSGAQGSGVPLPLTIISTAPRCQVAADG
NTESFLGDRQTLSVAPSPDTRCCAILGGGTAYDAYTMGMGMGMGMGMGGLTGSLGRRTLH
QQPTHFRQGACGEFVGVETLDILQGVAADSIIGIHTSAIMPTATSTSHYVPLQHNPYVDF
VPSSLILSMAPPPTISGNLSGTAMQTMPAIPTIPTMSLPTQTPKTQKRVTILEPTSRTTF
DPLLPTMVAAVVSTSTVTSTATTTPATPTPTQSGCSGGNDATLDRITLDLDYLLNRGAAD
AGEAGGVAPPPTSDDGQQKQ
Download sequence
Identical sequences 7227.FBpp0111945 FBpp0111945 FBpp0111945 FBpp0111945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]