SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112077 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112077
Domain Number 1 Region: 113-210
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000144
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 
Domain Number 2 Region: 216-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112077   Gene: FBgn0036202   Transcript: FBtr0113164
Sequence length 379
Comment type=protein; loc=3L:complement(11730166..11730383,11730449..11730607,11730686..11730808,11730885..11731029,11736906..11737129,11752726..11752996); ID=FBpp0112077; name=CG6024-PC; parent=FBgn0036202,FBtr0113164; dbxref=FlyBase:FBpp0112077,FlyBase_Annotation_IDs:CG6024-PC,REFSEQ:NP_001097587,GB_protein:ABW08526,FlyMine:FBpp0112077,modMine:FBpp0112077; MD5=535ce02bb25046edeecfa92b20cdfe4e; length=379; release=r5.30; species=Dmel;
Sequence
MLLMPTSCGPGPPNDHGPMSLPTSSPSCSKRARIPTRAADDDEPLRRSGTLTQRQSSGSG
IPQWLLILIGLLAILAQTPGSQVAAEKSKHYYMQSLCKNHFLQQLYRKIDGAVLWSQNER
NLDCIITFQTHSVLQRFMLRFDMLQLDCNDHLLVYDGAHAVATPKIDISCRNTKNTVNAL
LTRTNFVTLKYVTDGWGTDANGFKLVITSVKDPKHTCKDFTCATREFCIHPDLLCDGINH
CGDNSDESVQNLCQNETSSTVFGLDMTWFVLIVVGVLLVLSALIVAVAICVCRRQDENAA
NQNTALQVHHTADTNGSSKHLHYHGISVGGTLTREHTQLPTSGNWHHPAGPSGYHRTPHN
YLKMATKVRPIWCLANSVN
Download sequence
Identical sequences Q5BIG2
FBpp0112077 FBpp0304442 NP_001097587.1.81976 NP_001097589.2.81976 FBpp0112077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]