SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112209 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112209
Domain Number 1 Region: 904-967
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.93e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0008
Further Details:      
 
Weak hits

Sequence:  FBpp0112209
Domain Number - Region: 440-475
Classification Level Classification E-value
Superfamily ARM repeat 0.0978
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112209   Gene: FBgn0039492   Transcript: FBtr0113297
Sequence length 989
Comment type=protein; loc=3R:complement(22951365..22952343,22952416..22953488,22953559..22954299,22954361..22954501,22976116..22976151); ID=FBpp0112209; name=CG6051-PB; parent=FBgn0039492,FBtr0113297; dbxref=FlyBase:FBpp0112209,FlyBase_Annotation_IDs:CG6051-PB,REFSEQ:NP_001097943,GB_protein:AAF56673,FlyMine:FBpp0112209,modMine:FBpp0112209; MD5=7d45fd387b3c3810d9f3b1f535d916d5; length=989; release=r5.30; species=Dmel;
Sequence
MDTFKRWLNKPKADDKSLLARFFHADRSLTAVASELDSFDGRAEPDRCTRLVSRLRQNQD
KVLAITNLIMEELLGEDRDPRAFRAKFPEEVLQENLAGQLWFGAECLAAGSSIMNRETES
KEMRPLAQAVTKSLGNVRVLLRDQCLKNNVPNSKTLHLDLNDSTTEQLYESLKIFDRLFA
EFELSYVSAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQEMVDAFDPGLMFSIPR
LAIVAGLVVYAKGPLNMDMPGDQLSEMFRPFRTILIKIRDLLRNLNNQELYQLEKLLCTN
EDINTKVPLGSSSIEAPSPEHSSHPTTSSSQNNNNSSNNNHSSSSTNTTSTTTTTAGTTN
THRTVERLVDQRNNNHNSNSNSSTNPTVEAATLRSPSMLSLSATSTPTASPAPSPTPSHS
IASTSSAATSSTNPPADWSDGDDEDEDDDDIDVDEEDIESSDDGTDEEQLLKDIVSADCA
SGYLIPNTNLGNLLQPQEVPLTDNFVASEDDEYGTAEQQGHQGLEEDEPSTSAAMLAATR
TLQRLRLPSSDNEPLAEPTTIKASEEHMQQPSGRHRDSHSHRHHQRHHHHHHHRHPHQHQ
HRQPHPHRTTRSGRKRCSLEAADPERIQPDREQNLASGDTSAASSLSDDVSLAMRNTTAR
LKFKSTENLLHRLFVCIAGVADQLQTNFASDLRQILRSVFLMNMSTAQEEIDIPEKTKES
ELFEFRASENDVIQESAGSNQSIYSAEEVNPELDNVFSAGGGNQATGQRHSAGASMQRNN
TIDLASQPGEGSPSGATTATSRSHVTRSRSLGDQEAASSATSSTAQLRQLEQQQQQQQLQ
IQLQRQRNNSVGSNTPSSASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSAT
LSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRV
CRDCYVREVRSGMGVQGVQSVQSVQASAS
Download sequence
Identical sequences A0A0B4K6M9 Q9VB70
7227.FBpp0112209 FBpp0112209 FBpp0293587 FBpp0112209 NP_001097943.1.81976 NP_001247325.1.81976 FBpp0112209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]