SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112213 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112213
Domain Number 1 Region: 370-433
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000167
Family HAT/Suf repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112213   Gene: FBgn0039600   Transcript: FBtr0113301
Sequence length 501
Comment type=protein; loc=3R:join(24637837..24637876,24638117..24638208,24638427..24639273,24639340..24639536,24639603..24639932); ID=FBpp0112213; name=CG1646-PH; parent=FBgn0039600,FBtr0113301; dbxref=FlyBase:FBpp0112213,FlyBase_Annotation_IDs:CG1646-PH,REFSEQ:NP_001097958,GB_protein:ABW08794,FlyMine:FBpp0112213,modMine:FBpp0112213; MD5=ee2c879ae853723861cf9514c8c243c5; length=501; release=r5.30; species=Dmel;
Sequence
MASEGENVVMESPGRRTRSGRKAASPAASLPTRSTRRTSKRNVQLSDHEEEAEEQVVMVQ
EEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAELHSE
TSDDIKETRGQAGVDTLLASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQMEKM
NSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLPSKPEINDAEEVSDEELPAPQ
RAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTKDKS
SEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEKERK
KLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYA
DYEKRKGIKANCYKVSTPLTFGRANKYLSQFLVLRLQLRLQLIFIYLLLNAIYYDLIKIL
HSINATSTKIHQIEKTKPNLP
Download sequence
Identical sequences FBpp0112213 NP_001097958.1.81976 FBpp0112213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]