SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112226 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112226
Domain Number 1 Region: 281-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.61e-46
Family Ribonuclease PH domain 1-like 0.0000599
Further Details:      
 
Domain Number 2 Region: 213-315
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.62e-24
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00058
Further Details:      
 
Domain Number 3 Region: 48-130
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-24
Family Ribonuclease PH domain 1-like 0.00033
Further Details:      
 
Domain Number 4 Region: 443-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-23
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 131-221
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-21
Family Ribonuclease PH domain 2-like 0.0034
Further Details:      
 
Domain Number 6 Region: 549-623
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Domain Number 7 Region: 620-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000282
Family Cold shock DNA-binding domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112226   Gene: FBgn0039846   Transcript: FBtr0113314
Sequence length 721
Comment type=protein; loc=3R:complement(27227776..27228304,27228377..27229597,27229658..27229906,27230057..27230077,27230134..27230279); ID=FBpp0112226; name=CG11337-PC; parent=FBgn0039846,FBtr0113314; dbxref=FlyBase:FBpp0112226,FlyBase_Annotation_IDs:CG11337-PC,REFSEQ:NP_001097990,GB_protein:ABW08815,FlyMine:FBpp0112226,modMine:FBpp0112226; MD5=f90a4714d34a757e0b3e179a49ffc54f; length=721; release=r5.30; species=Dmel;
Sequence
MAMIFTRKSLKLLNYRLKCLSLSCPGGRRGIQSSSNGEAPSVEVNFSNGRNMTFSSGRIP
MNFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINAA
SMALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGKG
NVVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCEM
RLREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELIF
ERGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLAA
LDSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVRL
TSEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRILT
DILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMSE
AIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVFA
PSQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNSQ
LDQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPALGIPRSLNKSAGESG
T
Download sequence
Identical sequences FBpp0112226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]