SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112299 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112299
Domain Number 1 Region: 409-669
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.000000995
Further Details:      
 
Domain Number 2 Region: 308-400,669-716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 32-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 232-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 109-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 6 Region: 153-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 195-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 73-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 279-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000109
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112299   Gene: FBgn0051092   Transcript: FBtr0113387
Sequence length 861
Comment type=protein; loc=3R:complement(21525707..21525748,21527031..21527177,21527247..21527383,21531653..21531757,21532009..21532207,21532538..21533935,21535013..21535239,21539259..21539378,21539564..21539683,21544120..21544210); ID=FBpp0112299; name=LpR2-PF; parent=FBgn0051092,FBtr0113387; dbxref=FlyBase:FBpp0112299,FlyBase_Annotation_IDs:CG31092-PF,REFSEQ:NP_001097929,GB_protein:ABW08769,FlyMine:FBpp0112299,modMine:FBpp0112299; MD5=a7b128a465055ddcd280b037bd3fa1af; length=861; release=r5.30; species=Dmel;
Sequence
MGPICRILGCSFLLLIAGLVPHHASRVVGLESTCSQEQFRCGNGKCIPRRWVCDRENDCA
DGSDESTSQCRGLCSSLMFMCKNGEQCIHREFMCDGDQDCRDGSDELECGNRTCRSDEFT
CGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNFFACKSGPCIPNQWVCDGDSDCR
NGEDEMQNCTVSLLNFCQAGEFQCSDRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCR
PDQFQCNDQSCIAGHLTCNGKRDCADGSDEIMCDISATPRTCNATTEFDCGGGLCIPNAK
VCNRRKDCPNGEDEPAGKCGINECSSKNGGCMHQCVNLEVGYRCECHDGYKLGADQHTCV
DIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHTRCKASEGHASLLLARRHDIRKI
ALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQSIYKAPIDEGNDRTVVLTKSSVT
SDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSD
WGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNTISSSNYDGSQR
HQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLEHPMVVH
VYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMCVEDLG
IPTVRPTAPMHRTIEQSSNSTTKLPQDGYSETPVETKTGNNRTDTSNQVHKSDAESENDY
VEIALHVIASLAGTALVASVIYVVYRRCTRAVNSMNFENPVYHKTTEDHFSLEKNGTPHI
YAAANDEEAVNPLFKSGTECV
Download sequence
Identical sequences Q7YTZ6
FBpp0112299 FBpp0112299 NP_001097929.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]