SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112409 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112409
Domain Number 1 Region: 346-624
Classification Level Classification E-value
Superfamily Kelch motif 7.59e-82
Family Kelch motif 0.00000406
Further Details:      
 
Domain Number 2 Region: 64-186
Classification Level Classification E-value
Superfamily POZ domain 2.22e-25
Family BTB/POZ domain 0.0026
Further Details:      
 
Weak hits

Sequence:  FBpp0112409
Domain Number - Region: 230-266
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 0.0288
Family Hypothetical protein YhaI 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112409   Gene: FBgn0040038   Transcript: FBtr0113686
Sequence length 767
Comment type=protein; loc=U:join(1910298..1910620,1910673..1910957,1911012..1911276,1937072..1937194,1937255..1938562); ID=FBpp0112409; name=klhl10-PB; parent=FBgn0040038,FBtr0113686; dbxref=FlyBase_Annotation_IDs:CG12423-PB,FlyBase:FBpp0112409,REFSEQ:NP_001015101,GB_protein:EAA46324,FlyMine:FBpp0112409,modMine:FBpp0112409; MD5=d1166e9baca73e1e7b09451369b5960c; length=767; release=r5.30; species=Dmel;
Sequence
MSRNQNESNLLDINEDLPFALALPPVSMDSLQLNADGNSPEDKTLGIGRKTILNAHTKSL
APIVSDEALNTLNELREQNLLCDAQISVGEDVFNVHRAIMCSCSSYFRAQFTGFNADTPG
CVDGSDAKKNNNFIHIPGVSSCIMNCVIQYAYLRQTNISESNVHELLICADYVGMVGLVK
KCKDYLGRILTPENCVSIMGFARFRFLEDLHLKARNYTLRYFTEVAYRNIDILDMSAEDF
YSIISDDELNTREEDHVWKLCVKWIDRNPESRKRHVAHLMTGVRLGLMTPKCFMEEVKEH
PYVLECEAAKPLIVDTFKFMYDLDFLNPQADELTTPPLAMPRLPHEVIFAIGGWSGGTSK
GCIETYDTRADRWVTINAEDPAGPRAYHGTAVLGFKIFSIGGYDGVEYFNTCRVFDAVKK
KWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRS
DASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPNMNHRRSGVSCVAFRNQLYV
IGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDDMIFAIGGFNGVSTISHT
ECYVAETDEWMEATDMNIVRSALSANNIAGLPNKRDYIHKERDRLMEERRQRLMATAMAR
ENVGHGNASQMLVEHNDGAMDDYESPDEVDETDEQEQSARISRTIPPSVGLPNPAVAAET
IRDQSQLVSTAQLNRVMEDRGMDNNRSNRVQLRNQRHGSHHEIRRRT
Download sequence
Identical sequences Q6GKZ1
FBpp0112408 FBpp0112409 FBpp0112408 FBpp0112408 FBpp0112409 7227.FBpp0112409 NP_001015100.2.81976 NP_001015101.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]