SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112711 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112711
Domain Number 1 Region: 458-680
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.97e-46
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 83-445
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.2e-44
Family Ankyrin repeat 0.000077
Further Details:      
 
Domain Number 3 Region: 792-854
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.78e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0006
Further Details:      
 
Domain Number 4 Region: 679-772
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000233
Family Ankyrin repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 2-74
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000199
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112711   Gene: FBgn0039955   Transcript: FBtr0113988
Sequence length 861
Comment type=protein; loc=3RHet:complement(1685158..1685296,1685370..1686789,1687336..1688183,1688236..1688330,1688379..1688462); ID=FBpp0112711; name=CG41099-PA; parent=FBgn0039955,FBtr0113988; dbxref=FlyBase_Annotation_IDs:CG41099-PA,FlyBase:FBpp0112711,REFSEQ:NP_001104450,GB_protein:EDP28043,FlyMine:FBpp0112711,modMine:FBpp0112711; MD5=402748f6273bd698a2bb649abb821f4f; length=861; release=r5.30; species=Dmel;
Sequence
MALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQNCLLDLPSK
PSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQNIKGETPLHIAIARRNVEMVKL
LLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGARTDRTNSKTGDSLLQVFA
LDRHRGEKSAIFLADFADLDHINFRGLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCG
LKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSPLSLCLSLKRTTLVPTLIR
GGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEV
VDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHR
AIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLID
HGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHN
AAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFLLAIQVDVNSRVHDANQSSPLH
LAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDAD
GNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLE
SMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQL
LHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGIN
KPVRVCTVCFNVLQCGNGSLS
Download sequence
Identical sequences FBpp0112711 FBpp0112711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]