SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112712 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112712
Domain Number 1 Region: 719-942
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-46
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 249-497
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.03e-35
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 454-708
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-33
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 52-163
Classification Level Classification E-value
Superfamily POZ domain 7.85e-19
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 1053-1115
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.89e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0006
Further Details:      
 
Domain Number 6 Region: 922-1032
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000781
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112712   Gene: FBgn0039955   Transcript: FBtr0113989
Sequence length 1122
Comment type=protein; loc=3RHet:complement(1685158..1685296,1685370..1686789,1687336..1688183,1688236..1688330,1688379..1688504,1702561..1703297,1705902..1705905); ID=FBpp0112712; name=CG41099-PD; parent=FBgn0039955,FBtr0113989; dbxref=FlyBase_Annotation_IDs:CG41099-PD,FlyBase:FBpp0112712,REFSEQ:NP_001104451,GB_protein:EDP28044,FlyMine:FBpp0112712,modMine:FBpp0112712; MD5=1be39c8c6a293cb6ce87f6f4db610dc8; length=1122; release=r5.30; species=Dmel;
Sequence
MGSNETFSVLKMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSL
TVASLFDKNTYADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLS
LLRWIYTDLIDLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEV
GASTLLEYCSSIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLC
IQKYGNSLVNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKN
GDAFSANFLLDQNCLLDLPSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQN
IKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLS
MGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFADLDHINFRGLTALHIAALNNMP
NLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDING
DSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADIT
ALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRH
GIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDK
ASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDL
KLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFL
LAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERG
NLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPL
HELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC
LGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHC
GRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCGNGSLS
Download sequence
Identical sequences A8Y582
NP_001104451.1.81976 FBpp0112712 FBpp0112712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]