SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112713 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112713
Domain Number 1 Region: 721-944
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-46
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 251-499
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.36e-36
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 418-710
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-34
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 54-165
Classification Level Classification E-value
Superfamily POZ domain 7.85e-19
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 1055-1117
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.89e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0006
Further Details:      
 
Domain Number 6 Region: 924-1034
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000781
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112713   Gene: FBgn0039955   Transcript: FBtr0113990
Sequence length 1124
Comment type=protein; loc=3RHet:complement(1685158..1685296,1685370..1686789,1687336..1688183,1688236..1688330,1688379..1688504,1702561..1703297,1705885..1705894); ID=FBpp0112713; name=CG41099-PC; parent=FBgn0039955,FBtr0113990; dbxref=FlyBase_Annotation_IDs:CG41099-PC,FlyBase:FBpp0112713,REFSEQ:NP_001015359,GB_protein:EAA46090,FlyMine:FBpp0112713,modMine:FBpp0112713; MD5=cc430e2573a2f603fe3b8d690bd0566a; length=1124; release=r5.30; species=Dmel;
Sequence
MKTGSNETFSVLKMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRL
SLTVASLFDKNTYADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVV
LSLLRWIYTDLIDLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAE
EVGASTLLEYCSSIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVS
LCIQKYGNSLVNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSAL
KNGDAFSANFLLDQNCLLDLPSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINI
QNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASIL
LSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFADLDHINFRGLTALHIAALNN
MPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDI
NGDSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGAD
ITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILV
RHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQ
DKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDI
DLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVL
FLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIE
RGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRN
PLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAG
ACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCR
HCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCGNGSLS
Download sequence
Identical sequences Q7PLP5
FBpp0112713 7227.FBpp0112713 NP_001015359.1.81976 FBpp0112714 FBpp0112713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]