SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112714 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112714
Domain Number 1 Region: 708-931
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.59e-46
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 238-486
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.21e-35
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 445-697
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-33
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 41-152
Classification Level Classification E-value
Superfamily POZ domain 7.85e-19
Family BTB/POZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 1042-1104
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.84e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0006
Further Details:      
 
Domain Number 6 Region: 910-1021
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000233
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112714   Gene: FBgn0039955   Transcript: FBtr0113991
Sequence length 1111
Comment type=protein; loc=3RHet:complement(1685158..1685296,1685370..1686789,1687336..1688183,1688236..1688330,1688379..1688504,1702561..1703268); ID=FBpp0112714; name=CG41099-PB; parent=FBgn0039955,FBtr0113991; dbxref=FlyBase_Annotation_IDs:CG41099-PB,FlyBase:FBpp0112714,REFSEQ:NP_001015360,GB_protein:EAA46089,FlyMine:FBpp0112714,modMine:FBpp0112714; MD5=c8272770c46bdbfb340ac58d86ede19e; length=1111; release=r5.30; species=Dmel;
Sequence
MEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNTY
ADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLID
LQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCSS
IISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSLVNT
FSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLD
QNCLLDLPSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQNIKGETPLHIAI
ARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGARTDRTNSK
TGDSLLQVFALDRHRGEKSAIFLADFADLDHINFRGLTALHIAALNNMPNLVKKLIVNGA
SSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSPLSLCLSLK
RTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADITALTENLDSALD
LSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRHGIDTDCWDEGP
EGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDKASPLHLCCHWG
QTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDLKLRDKSGNTPF
ATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFLLAIQVDVNSRV
HDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERGNLPAVSALIQN
NADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPLHELCRVVEDST
AGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGACLGTENKDGINI
FNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHCGRVLCSKCSCN
DVPILKFGINKPVRVCTVCFNVLQCGNGSLS
Download sequence
Identical sequences Q7PLP4
NP_001015360.1.81976 NP_001104450.2.81976 FBpp0112714 FBpp0112714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]