SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112919 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112919
Domain Number 1 Region: 1922-2138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-26
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 1598-1641,1707-1863
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-25
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 1025-1254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-25
Family Laminin G-like module 0.00074
Further Details:      
 
Domain Number 4 Region: 1311-1520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-23
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 209-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000962
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 289-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000143
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000711
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 329-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000121
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 249-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000341
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 136-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000471
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 1254-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000571
Family EGF-type module 0.034
Further Details:      
 
Domain Number 12 Region: 1536-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 365-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  FBpp0112919
Domain Number - Region: 1867-1903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0297
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112919   Gene: FBgn0031414   Transcript: FBtr0114370
Sequence length 2165
Comment type=protein; loc=2L:join(2323799..2324256,2327404..2327552,2338380..2338532,2338765..2341094,2346827..2347179,2350759..2351031,2352444..2352736,2352802..2353462,2353538..2353701,2353769..2354500,2354580..2354822,2356431..2356931,2357690..2357877); ID=FBpp0112919; name=eys-PC; parent=FBgn0031414,FBtr0114370; dbxref=FlyBase_Annotation_IDs:CG33955-PC,FlyBase:FBpp0112919,REFSEQ:NP_001027571,GB_protein:AAZ83988,FlyMine:FBpp0112919,modMine:FBpp0112919; MD5=d867b597bc51f2e1c8ec91901c7694a8; length=2165; release=r5.30; species=Dmel;
Sequence
MAESPQIRRDMGRLCATWPSKDSEDGAGTALRAATPLTANGATTTGLSVTLAPKDMQRNH
LLKMPTATIEKPTITATIASSSSTSTSTTRKSVTATRSLKLNPNILLPTLRILARGLLLP
ALILAILVGSSQAGFACLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPC
QNGGTCVDGVAYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQPGYL
GSHCELDVAVCETGTGARCQHGGECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQN
GGVCVDKLAAYACACPMGYTGINCEEEILICADNPCQNNALCLMEEGVPTCYCVPDYHGE
KCEFQYDECQLGPRCMNGGVCIDGVDTFSCSCPPLLTGMLCECLMVGEESLDCNYTAPAT
QSPPRRTTTTSTMAPPTVRPVTPPETTVSPSRASEEVEIIVVTTSAPAEVVTSVLSPSSS
SSSSEEGVSVEIKTPTVAPPESGSHSISVEQTTAVPAQPEPESEQEPESKPHPESESASE
SETETEEEIIPGTTARPPTSRSSSSSEESPSIFTTLPPLPGKPQTSASSESSGEVVTSEE
YTTVPHFEVSGSKSESGSEEVTTVRPTAAPSITISVDITSSGSSSSSSESVEVFTTPAPV
FVQRVTTIETSISIDYVTPTPLPETTTPRVVPVPRPTFAPEPPLDVVETTASTHHLWTEV
PTTAAPFFTEYPAEVLITTHRTSAGRFTTVQPPAGVTTTSPTEDSSVELPTPHTPQIVVT
ILDSNEVIPSLITTTGSPTTHHHHHHHPHHEAEGTTLQPLEEDEHHHHHHHDEFTTPQPV
EITTGHPLQTEDLIGVQEPAVVTTESPFAPAETTVVPVVVPATIAPLGTAAPPATPAPVP
PATTTPPPSPPSLATETPTLPPTLPPVTLPPVTQPPPTIPPTPPSTQSAQTLPPPTSAIN
VYTTPDGPPTASQTKPSVTESSEEVEGTNTVSTGGRGSGGVPEEKAGDVDCIKLGCYNGG
TCVTTSEGSRCVCRFDRQGPLCELPIIIRNAAFSGDSYVSHRIYKDIGGHESLDAVLPMH
IQLKVRTRATNGLIMLAAAQGTKGGHYMALFLQKGLMQFQFSCGLQTMLLSELETPVNTG
HEITIRAELDFSRNYTHCNASLLVNDTLAMSGDQPTWLKLLPPRLHTPEAILNTWLHLGG
APQAPIGLIIELPPAQSGSGFTGCLHTLRINGQAREIFGDALDGFGITECGSLACLSSPC
RNGAACIKIETNDLDENGEKAEKWKCKCPTGYMGPTCEISVCEDNPCQYGGTCVQFPGSG
YLCLCPLGKHGHYCEHNLEVALPSFSGSVNGLSSFVAYTVPIPLEYSLELSFKILPQTMS
QISLLAFFGQSGYHDEKSDHLAVSFIQGYIMLTWNLGAGPRRIFTQKPIDFRLDAPRVPY
EIKVGRIGRQAWLSVDGKFNITGRSPGSGSRMDVLPILYLGGHEIANFNTLPHDLPLHSG
FQGCIYDVQLKAGQVTVPLQETRGVRGRGVGQCGTRECHRHACQHDGACLQHGATFTCIC
QEGWYGPLCAQPTNPCDSFNNKCYEDATCVPLVNGYECDCPVGRTGKNCEEVIRSLSDVS
LTGRRSYLAVRWPYLYDGGDKLGAKRSQMVSYRNFTKKLMPPKPITTPSSHFVMKLLNEV
EKQRSFSPVPLMGSKSFEEHHRVQFFFIEFQLRPLSERGLLLYFGTLNNNQDKKIGFVSL
SLQGGVVEFRISGPSNHVTVVRSVRMLAIGEWHKIKMAQRGRWLTLWVEGSASSALAPSA
EVLVEPDSLLYIGGLKDVSKLPHNAISGFPIPFRGCVRGLVVSGTRIVLNETNIVESRNI
RDCDGTACGGDSCESGGHCWLDEKLQPHCICPEYAKGDRCEYSETCKLIPCKNNGRCLRS
GRCSCPNGWGGFYCEIAMSKPTTPSFRGNSYLILPPPRIPMKDKRRGPSLYVRPREAIQV
SLNFSTIEPDGLLLWSEHERSKFLGLGLEAGHLKLASNLLGSTNDTVRAPASGFIADGAW
HWTSVLLDRSRLELQLDGEVIFTERLPEGGRSLGSTTPRSTLAGRRKNSSKEPTISYEDV
FYLGGFPNSDSVSRRTKGRFFDPFKGCLQDIQFGAEPTAIISDFSTYQGENIGSCDLHGD
EPLTV
Download sequence
Identical sequences FBpp0112919 FBpp0112919 7227.FBpp0112919 FBpp0112919 FBpp0303537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]