SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271833 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271833
Domain Number 1 Region: 392-845
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.48e-115
Family L-arabinose binding protein-like 0.0000000103
Further Details:      
 
Domain Number 2 Region: 68-148
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000122
Family L-arabinose binding protein-like 0.00091
Further Details:      
 
Weak hits

Sequence:  FBpp0271833
Domain Number - Region: 862-919
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0292
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271833   Gene: FBgn0050361   Transcript: FBtr0273325
Sequence length 1415
Comment type=protein; loc=2R:complement(4362920..4363449,4363981..4364164,4366829..4366980,4367358..4367571,4367686..4367848,4367930..4368064,4368722..4368912,4369149..4369282,4369453..4369602,4370111..4370217,4370361..4370532,4370637..4370745,4371108..4371250,4373663..4373807,4374323..4374493,4376722..4376864,4380726..4381685,4408619..4409063); ID=FBpp0271833; name=mtt-PD; parent=FBgn0050361,FBtr0273325; dbxref=FlyBase_Annotation_IDs:CG30361-PD,FlyBase:FBpp0271833,REFSEQ:NP_001137619,GB_protein:ACL83073,FlyMine:FBpp0271833,modMine:FBpp0271833; MD5=a363612a1ea436c19ff39d5cad254638; length=1415; release=r5.30; species=Dmel;
Sequence
MTTANIVAAPAAPTISPAITSTATRIGGKAVPTPRLLGSGAANVAQILAKSLDSPSPSSS
SGWPVKHAAVLEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLYTLDQVNKQQLL
PNVTLGAHLLDDCDKDTYGLEMAVDFIKAHIQINSEYITVKTEAKAKMKTFCDESKWSVQ
ICLLLLLVVLSTCHILQTESQVVGDIEQADDGVASSHRRSRSHSASHQAHVGNGNNPGCK
HLHHRQHRGKSHARKHRQSHYEMLELEQRQQRMGKHWRQWMSHLQSPDYANDDPLPDGRR
SSPANADLTYDHFELEDYQRYANIDLASPRSGRHRGRHLPLNNMNLMLPLSSADGSGKYL
RSLPDSVSFQNDRLYATQPQRHWPVKREAIVEGDVILGGLMMVHSREDSITCGPIMPQGG
IQALEAMLFTIDRINREQLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYH
CNKTQVRKVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIP
SDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSG
VAEDIAYDNIVQKLLTKPRARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARN
LVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGST
STPYNNYTKQCTTKERLSRQNTDFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPSLCEAM
KPTKGADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQSQAGQYHWVKVGEYTE
GELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDE
THCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHND
TPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKT
NRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTRED
NLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLA
FVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMPPRYG
NMHRTAGTGPSSMMAAAVVTAATCAQEEKIQKHITPTNTENSLKTKKLCEMATQTISSII
TSLDINAYNQIPYADQYVPNNATTATTTPTDKGSGNGNSNSNSNTNGSSNSNSNSNGDGD
VATEQVVANNNKINQRQHGQPAVAFAITSTNNHISGPAATITTTAATGETTTEALVATIT
TPLATVDGSETMSVAPNNGHGNNGSQRPPVLQTNL
Download sequence
Identical sequences B7YZT0
FBpp0271835 7227.FBpp0271833 FBpp0271833 NP_001137619.1.81976 FBpp0271833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]