SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271835 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271835
Domain Number 1 Region: 225-678
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5e-115
Family L-arabinose binding protein-like 0.0000000103
Further Details:      
 
Weak hits

Sequence:  FBpp0271835
Domain Number - Region: 695-752
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271835   Gene: FBgn0050361   Transcript: FBtr0273327
Sequence length 1248
Comment type=protein; loc=2R:complement(4362920..4363449,4363981..4364164,4366829..4366980,4367358..4367571,4367686..4367848,4367930..4368064,4368722..4368912,4369149..4369282,4369453..4369602,4370111..4370217,4370361..4370532,4370637..4370745,4371108..4371250,4373663..4373807,4374323..4374493,4376722..4376864,4380726..4381629); ID=FBpp0271835; name=mtt-PF; parent=FBgn0050361,FBtr0273327; dbxref=FlyBase_Annotation_IDs:CG30361-PF,FlyBase:FBpp0271835,REFSEQ:NP_724683,GB_protein:AAF59082,FlyMine:FBpp0271835,modMine:FBpp0271835; MD5=d6b8986d553a057c401b13fc5e078734; length=1248; release=r5.30; species=Dmel;
Sequence
MKTFCDESKWSVQICLLLLLVVLSTCHILQTESQVVGDIEQADDGVASSHRRSRSHSASH
QAHVGNGNNPGCKHLHHRQHRGKSHARKHRQSHYEMLELEQRQQRMGKHWRQWMSHLQSP
DYANDDPLPDGRRSSPANADLTYDHFELEDYQRYANIDLASPRSGRHRGRHLPLNNMNLM
LPLSSADGSGKYLRSLPDSVSFQNDRLYATQPQRHWPVKREAIVEGDVILGGLMMVHSRE
DSITCGPIMPQGGIQALEAMLFTIDRINREQLLPNITLGAHILDDCDKDSYGLEMAVDFI
KGSISNIDDAEYHCNKTQVRKVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELS
NKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNI
CIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARGAIIFGSDQEVRQVMRAVRRANATGS
FSWIGSDGWSARNLVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEF
WEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNTDFEDQLQFVSDAVMAFAYALRDMHR
DLCGGGPSLCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQSQA
GQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCF
NCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILV
TLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGF
CFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIA
PSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHI
GFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPE
RNVRQSMMPPRYGNMHRTAGTGPSSMMAAAVVTAATCAQEEKIQKHITPTNTENSLKTKK
LCEMATQTISSIITSLDINAYNQIPYADQYVPNNATTATTTPTDKGSGNGNSNSNSNTNG
SSNSNSNSNGDGDVATEQVVANNNKINQRQHGQPAVAFAITSTNNHISGPAATITTTAAT
GETTTEALVATITTPLATVDGSETMSVAPNNGHGNNGSQRPPVLQTNL
Download sequence
Identical sequences A1Z7F5
FBpp0271835 NP_724683.2.81976 FBpp0271835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]