SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271879 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271879
Domain Number 1 Region: 733-829
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000392
Family PKD domain 0.011
Further Details:      
 
Domain Number 2 Region: 523-617
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000471
Family PKD domain 0.0078
Further Details:      
 
Domain Number 3 Region: 428-520
Classification Level Classification E-value
Superfamily PKD domain 0.00000000693
Family PKD domain 0.0071
Further Details:      
 
Domain Number 4 Region: 619-663,690-729
Classification Level Classification E-value
Superfamily PKD domain 0.0000222
Family PKD domain 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0271879
Domain Number - Region: 353-424
Classification Level Classification E-value
Superfamily PKD domain 0.000173
Family PKD domain 0.0069
Further Details:      
 
Domain Number - Region: 238-287,923-966
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271879   Gene: FBgn0035833   Transcript: FBtr0273371
Sequence length 1089
Comment type=protein; loc=3L:complement(8081098..8081300,8081369..8081536,8081596..8082112,8082172..8082362,8082425..8082725,8082782..8084065,8084132..8084737); ID=FBpp0271879; name=CG7565-PB; parent=FBgn0035833,FBtr0273371; dbxref=FlyBase_Annotation_IDs:CG7565-PB,FlyBase:FBpp0271879,REFSEQ:NP_001137906,GB_protein:ACL83261,FlyMine:FBpp0271879,modMine:FBpp0271879; MD5=a6db5e0862de39e1bf5906564d770de0; length=1089; release=r5.30; species=Dmel;
Sequence
MVQVGKRICNLLLLATAMSSAYADVTTQNALLVGSKKHKETSPDNSVGGSISPNLVCHKM
LRHVFENATPRDEQQAGVFEEYKPPPDAVEPLEEEAYLWNCLQACCEKPRNGSSACNVVL
VFKAKCYHIRCQSNEACLPKLRVRMPNEKVQMVLVNPLGDATWPQLLKAEAAKQNAEILP
YDEAALNFWKQPRRLSYLARNQETPVYEDEDFPLADKRMNQMIFQPDENDVLANEELGYY
DSNAKFTTCDMETPCPPPQQCVPLQPNAVRGVCTCPEGFVWNKQRKCVMAAVPYSSYLTS
NEAGQQEAAASENSPEVSTPPLKAEQNKDIVVSVMSKEVRLPEQEVTLAAFTVPDEQTSD
TKYKYLWTLISQPKGPMNGTISDQSKSKVKLSNLSEGLYTFKVTVTGDNGTFGEATANVT
VLPENRINQPPQVIISPREQIIRQPTTNAILDGSTSTDDDKITNWHWEVISGPIGYQPVL
PEVNTLQLDLTSPGNYTFKLTVTDSNNVTNSTTATIAVLKETDYAPVANAGDAVILYLPN
NNVTLNGTASSDDHEIVAWEWTKDASDEAKAVDMQNTRTPYVQLSNLEEGMYTFVLKVTD
GSGQSSTAKVHVFVKPPTNSPPVAEAGSNTTTSLPINWVLLNGSDSKDDIGIKSYLWKQL
SGPNNAVILKSNSSVSAYIYIVMLDLMQLHLTLQIANATSLTLGLYEFELTVADENNNTA
TDTTWVKIVQERNAAPIANAGGDHTVTLPATAIYFNGSKSWDDLAVVKYLWTRDEHSLAA
GVIVADTDKEPVMILTNLVQGRYVFTLTVSDDQGLTSSDTVSVNVRRDPKLLNLVQMTLP
MGISVLVQSELDSVVQKLQLLLGDENKIQVRELKYDLHTDATVLVFYVNDGQGKALDGLQ
VERQLRTQLQKDASILGAFAVDIRTSVCQSDCSGHGSCNPITRACICEAFWMPSAGYFFN
NQEANCDWSILYVFVGVIVGCLLLSGVFWGIACACRQSKKPRLRQKVQKYSLIGNKDEEA
ANYSRNTSLTESETDSDVLFETRTKSNGLGKHKSHNSHSHGHGSSGGSGSSGRDGHKYGT
QKLGRKIKA
Download sequence
Identical sequences FBpp0271879 7227.FBpp0271879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]