SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271945 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271945
Domain Number 1 Region: 1099-1211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1438-1550
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-31
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 3 Region: 626-736
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-30
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 4 Region: 505-627
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-29
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 5 Region: 1554-1668
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-29
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 6 Region: 1791-1900
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-28
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 978-1094
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-28
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 8 Region: 1215-1330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-27
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 9 Region: 3622-3733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 2272-2379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-25
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 11 Region: 3249-3363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-22
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 12 Region: 853-970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-21
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 13 Region: 2895-3013
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-19
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 14 Region: 2033-2133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-16
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 15 Region: 3010-3127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000183
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2138-2244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000903
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 17 Region: 3129-3249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000109
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 18 Region: 2514-2636
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000366
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 19 Region: 3384-3439,3465-3508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000157
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 20 Region: 741-853
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000275
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 21 Region: 154-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.007
Further Details:      
 
Domain Number 22 Region: 2758-2891
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000837
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 23 Region: 2382-2511
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000445
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 
Domain Number 24 Region: 1330-1434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000484
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 25 Region: 1912-1997
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 
Domain Number 26 Region: 467-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000665
Family EGF-type module 0.017
Further Details:      
 
Domain Number 27 Region: 3529-3606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000131
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 28 Region: 205-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.021
Further Details:      
 
Domain Number 29 Region: 1670-1772
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000222
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 
Domain Number 30 Region: 427-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000042
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 31 Region: 239-368
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000345
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0271945
Domain Number - Region: 383-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0362
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271945   Gene: FBgn0052702   Transcript: FBtr0273437
Sequence length 3750
Comment type=protein; loc=X:complement(9452794..9453047,9453106..9453781,9453852..9455645,9455708..9456205,9456274..9458600,9458660..9459341,9459409..9459773,9459874..9460036,9460103..9461839,9461909..9462604,9462671..9463423,9463489..9464241,9464487..9464670,9464906..9465181,9465247..9465341); ID=FBpp0271945; name=CG32702-PB; parent=FBgn0052702,FBtr0273437; dbxref=FlyBase_Annotation_IDs:CG32702-PB,FlyBase:FBpp0271945,REFSEQ:NP_727348,GB_protein:AAF46505,FlyMine:FBpp0271945,modMine:FBpp0271945; MD5=d9ac527299cb9b3c0e34a383d8436c83; length=3750; release=r5.30; species=Dmel;
Sequence
MEGAARSRLLLCWTLLAIITDTWPIAEGFVNSPKIISKDGNLIFESGANRNISFRLSGNS
RLTINEELDVMELLLATSGSKKRSGGKDDDFVDARELADQLADFNRRAFGANGLSAMLRV
QQNRTRGSMALLRRFQTRLRALENRVDRMKTDLEANSCASGPCENGGTCYNTYTGFRCQC
RSAFEGTKCEMDVNECALYEGTDLGCQNGGQCQNHFGTYSCLCQPGWHGMHCTQRKADCS
QSSAWELCGHGSCVPSADDAGYRCICEPGWKTNGLTPICGEDVDECSDSAAHKPCSTSCI
NLPGSFTCAPCPAGLTGNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPVGWT
GDGRKCERSPQDIDIPAGQTPRTCPAGNNPCYPTASCFLISGTTSCRCPMGMVGTGYGPN
GCVNGTTTNCKENPCLNGGICLFAGPSNYTCLCPIGFRPPICEPQPSPCDQHPCKNGGRC
RPTTSGDLFVCQCLPGYRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIR
TNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQ
LYLWFRSDNSTAKEGFDLTWNSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVA
PTTKRIKLTFFSLQLEQHANCNFDYVLIKDSISGRELAKYCTTGAPAPLLLPTHLAEIHF
HSDAEGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGE
QVVIQFARLELDPLDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYA
RAGSFQLNYRMACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQL
TNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSM
GRGFKFEYRALATGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHW
NSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSD
YSESDGGFDLTYTFEDRAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEI
QVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAI
NGRGFRLRWRIFAFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIED
LELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNT
FRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSHLA
RHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVHNASNVNFQLDYRIDGCM
EELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVS
NHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGKLTA
RNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTED
DTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHESCGQTIIVDET
MFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKI
YEGTEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGHYMTMDTSCGSIYNALS
GKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVREESESGQ
LIGVYCGNEVPGVIHSRGAIWMKFKSDDDNVGEGFMASYNYEHHNELNGTEGTIESPHFP
SKFQDPVPYSWRITVDKEYVVAISLLYLRDLDQPHLNFYDGYSDIGARIEVTDPDETIIS
STNVVYFTSNRGPFKLNWNRLSKEALRSNRTAEERTRQCGNQLITIDRSVIGFHSPGYPN
GYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQNWSELRTLC
SLPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVRTACGSEITASKGLVNITEILKVL
PRPNHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGK
YCEDVVHEVLNTSSNKAYIKFHFASPPRFLVSFRFEELRYTDSGRIRLSASGDEQFISSP
YYPHLPHPHSECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQREFVLINDGSTELRP
EIGRYCGNRKPDTIYSTGNQMRIRYFTDVSEPHMGFNASLSVARCGGSFHSPEGVIASPS
RDLLLIHEEGKQLQECVYTIELEKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFG
LDGEEKIVDTLMLCGMEAKHLISETNKIVFRYRFLDGIPAENQGFRLKYTSLGSRCGETI
YASVGVLQTPGYPLGVPHPMHCKWQVQVPKGRRVRLEILDFNTGTNMDLRGRLGFRGRLT
VANDFKMQSILGRYNVDPPAEVLSSDNTMGIDAFLLPIVQNHGIKLRFSAYGSSSCPGFT
VMMNEVADIQFQRFNISRPLHCSYKVVPPSNSTLLIRVKEYNTTSVMMWNTHMCALLSPL
KFNRLEQEEELMERILCDYQSPAPGKPLPSIRLPFPIQLVVSASARNAMTNLVLSYSTQS
CGGVIILEPGDNMTVHQPSGMVSAAGAIDCAWAIGPYTDASGEDEVLVPQDIQLEVSVYN
VNLPAPSPSAQSPEAPCLHHYLKVYNGPDQNSPSLGLFCNQATAVNMVVERGLFLEYHSD
SFSANATFNVSIKYGSGCGGKLVYPYRAIDFAEQYKNNVECIWEVEATMGYHIGLTFQGR
FYIEDSPGCTKDYLLVQQRNETTGNWTDLQRICGRVAPEMINTTSPYLRLIFRSDGDVVA
DGFLAKFERNCGGLLYADSTEQELASPGFPNGYEKYLQCNWTIVPRSPSMGGVLVSFVNF
DLEQGPISVCLYDNLTVTTKDKGKDPQQTTLCGVKHNHEYRGKEYVNLLLRTDGSYSGRG
FTLLYTSRLCGGIISRTSMVESPVQHTDNTLPPGSDCYWNLTAPAGYKFNIKFLFIDFEA
NSNCAYDGVEVFSGPIPDERYRWGRFCGRINEDLPLISIPQERGIIHSFSDDRDPSRGFR
ALVRVMPNCDEKISLNGSSRYVYSKFNNAGGYQNDLDCQIVFRVNPDQQISVEFSNFHVQ
DTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDNKVTDTGFQVT
INAIPRLCGSSEITLSADGTKEVTINSPARTPGGNYPNGVSCFWKIKGDSLLRVQFVNFD
LHGPNQNGSCVDDYLKIYNSEDAPLLEQGLGTDLVFNGQTSSKNGFGFATEHVYCGNVKP
DIYYGRSSEVYLKFRSKGLEQHGGFQLQVALNSNRERHYDGLQGRVHLSQSADCNIIIRA
PPNYTLSLYYTELIFGTYDCEMENLEVFDRTNRSLQRVCSFVDMGKSLFSNANELRLQMK
TGSYLTSLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYPNNVRNNSECQWIVRVPSNNV
VFLTFEVFNLGSKTTCHTDYLQILEQDATGEEREMRRFCGEDNPKYYKSRRSQVLVRFHK
TVNYDGIGWVIRFAGVYSDHQIPRHLLGGS
Download sequence
Identical sequences Q9W332
7227.FBpp0271945 FBpp0271945 FBpp0271945 NP_727348.2.81976 FBpp0271945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]