SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288397 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288397
Domain Number 1 Region: 368-760
Classification Level Classification E-value
Superfamily ARM repeat 1.9e-31
Family Plakophilin 1 helical region 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288397   Gene: FBgn0028421   Transcript: FBtr0289959
Sequence length 900
Comment type=protein; loc=X:complement(11228822..11228966,11229029..11229285,11229367..11230842,11230908..11231096,11231160..11231296,11231362..11231676,11231730..11231895,11232705..11232722); ID=FBpp0288397; name=Kap3-PK; parent=FBgn0028421,FBtr0289959; dbxref=FlyBase:FBpp0288397,FlyBase_Annotation_IDs:CG11759-PK,REFSEQ:NP_001096953,GB_protein:ABW09393,FlyMine:FBpp0288397,modMine:FBpp0288397; MD5=a2dc2d1fb9b16ed33229472c865c6c84; length=900; release=r5.30; species=Dmel;
Sequence
MIEEKKHCQKIIRLRSLNAKTDPAALAREVVEKCDLIHKSQLNDVEQIIFYLKNRKDNAS
NDIPDNNTHSRRSAALHTSHTRSSARSHSSVAAMTSSTGSGGGSTGASNGVSNALSAATP
TADVSINNIDEYVELLYEELGERIRGSAMILQMARNPDNLEELEKNEACLSALSRVLRED
WRKSLDLSTNIIYIFFCFSTYTKFHPLIVQYKIGSLCMDVIDYELRRYETMRNELDVRKQ
PNGSSTPHSAKASKEKLNRSTDDFLDIMNEEKPKEMEPPRRRIPELKQRPKSGNWSSFHG
SMSSSLIKSQILNSSYHESLCAGGSPGGDTPAVPAEQKAQSNESLDRNDPKVKKEEIDRL
NKQLKIFAKKQEQLLRVAFYLLLNMAENVKLEEKMRRKHIVKMLVKALDRQNIDLLMLVS
TFLKKLSIVGDNKDEMGALNIVAKLPRLFQSTHTDLVQVTLKLVFNLSFDGGLRRKMIAA
GYLPMLVMFINDEKHHGIAVKILYHMSLDDKVKGMFTQTECVQMATDAIILNLNVKVDLD
LIALCINLSLNRRNAQIMVEGQRLHSLMDRAFKYQDALLMKLLRNLSQHESLQLQFIDYV
GDLARILTICDDEAFIVECLGILGNLALTDLDYSQILQNFQLIPWIRQILLPCARMDDLV
LDTIVYLGTCACDELCALLFCRAKVVISLIELLKAKQEDDEIVLQIIFVFQQILRHESTR
EYMIKETESAAYLIDLMHDKNEEIRKVCDYCLDIIAISDSEWAKRIKLEKFRNHNSQWLC
MVESQQDQDNEQDYADQEDECDNDLDTYLRSEYLDNCDLYNDNADNDSNSNSNHSNNNPA
SPAMSTYSRPLSTYRRSQDLDDLYNMTSSSKSQGSSDNNYIFKSNKSLDADGLHEELLMA
Download sequence
Identical sequences FBpp0288397 FBpp0288397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]