SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288498 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288498
Domain Number 1 Region: 434-529
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000217
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.048
Further Details:      
 
Weak hits

Sequence:  FBpp0288498
Domain Number - Region: 938-987
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0667
Family TF C-terminus 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288498   Gene: FBgn0051678   Transcript: FBtr0290059
Sequence length 1417
Comment type=protein; loc=2L:complement(20659613..20660385,20660449..20661148,20661990..20663929,20663998..20664209,20674995..20675570,20675637..20675689); ID=FBpp0288498; name=CG31678-PB; parent=FBgn0051678,FBtr0290059; dbxref=FlyBase:FBpp0288498,FlyBase_Annotation_IDs:CG31678-PB,REFSEQ:NP_724277,GB_protein:AAF53910,FlyMine:FBpp0288498,modMine:FBpp0288498; MD5=fa1db2ee519b7d2331258f53fe31472f; length=1417; release=r5.30; species=Dmel;
Sequence
MHMRLHLVRFMFINLLLSCCFWLYDNVAAADSQIPSRAGDSAKDAARKTHIEPEEPAAPP
RPEPPPPPLHNGAGVLLPSAQEGVPIVATSSSSSFAEVPQTGNRPISGDTSVPVKELPAL
SDQQRTKSHSEYISEIDLAADVGGASSSTAQVPNNQLNYNKRSSAGKVHRFSESQQLDQP
KQLEQEEPATGQPKAPELQEPPQLPQAEESFPEIITELPAVTITELPLDRVMNRLDSVIL
DGSPATAGNHSDEEQHQQQQQPHEDQPMQVSEADEEVPQKDEQMPKINDPGGGIQVEGMV
TPEAATVGETQESSEELQPGSAAFNGTEGTANLTNANEEVPMPVFSEWAQKQMEAEASRE
QAMELEQQVVNKSAQRKNNTGSSSGKPPTLKLRSKNYASPDCGAKIIAHNSESKHTEAVL
TQSTDEYMLSTCESRIWFVVELCEAIQAQKVDVANYELFSSSPKNFTVAVSKRFPTRDWS
NVGRFAAEDKRTIQTFELHPHLFGKFVRVDITSHYANEHFCPLSLFRVFGTSEYEAFETE
IRPSDDLDDFYDDYGAQEQKAAVGSGGNIFQSASDAVMQMVKKAAEVLVKPTKALKWSEE
SVLCQTPAFEAFSCINCNTTLVERINSLLSCQFQQLQALLSLSHLRSDLLNSRVCQEEFG
ISLTGSEFASKMGKEQSYFLSMLPAEHVGAMCKLIQAEQNVTDHNHTKAPSLKQHVSSPE
PVQDNATATGVRQDCENSKTPTKEPLTPSLEVVVPEVSQEVPSMEDQSSTSSETVSTTNS
TPADVNIFNMPSEPEEVVVKVQLPPEPTLPTTLQPSDVESFTDAPSTNALPGSSEAVANG
DLGMEEGNPANWDGIDNLLTTTVASITAGGGAAAAAAAVVNGNANIGGAGIVGAGGPASL
SSVNMQQKLTNGAQSESVFIRLSNRIKALERNMSLSGQYLEELSRRYKKQVEELQQTLTQ
QTLTVRQLEDQSRRYVEQEQLYQQHSAELAGEVRALSYQVQACILVIIIVGTCIFLMLVL
GTVYYRKLRRQQQQLLKKDQAGHPPVAAKPKLDRRKSYEQTPNQSTPKQRRPSEEAMLIL
KECGDSNMQELDPPSRQRKISVCYGSNNNIAANMAIANTNGGASVRNSLHRRKGAKHSWH
NSLDTTETSCGEQTDKFFDVDTLKSIKQSCGKPGKKKSLQQLKPLGLKRQESAPATYTPD
LQAEEPATQSDFDESLMLDDDDLANFIPTSDLAYNEFMPEGPSGYQIVDTVDGKPGKEPG
TKKSRRLSSPAFFKSPFSKSKNKGYSFNGVKNSHAVHEPTSWEWYRLKRSEKHQQQQQAK
LVSKSLPSASLDSSSLSEVNFPLSSSTATTQNSFRILGEAILSSGEGRITPNGNGNAMSG
GLASSSSGSGSGGSTTSSTTKKKQRALNNLFRKAFDF
Download sequence
Identical sequences Q9VIK7
FBpp0288498 FBpp0288499 7227.FBpp0288498 NP_724277.2.81976 FBpp0288498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]