SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288558 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288558
Domain Number 1 Region: 830-978
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.11e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0089
Further Details:      
 
Domain Number 2 Region: 325-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1297-1445
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.63e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 209-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 5 Region: 15-172
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-22
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 6 Region: 2563-2772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-19
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 7 Region: 436-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-18
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 8 Region: 674-745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 9 Region: 1050-1114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 2204-2334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 3168-3316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000957
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 12 Region: 2059-2096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000347
Family EGF-type module 0.008
Further Details:      
 
Domain Number 13 Region: 166-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 2174-2217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000616
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 15 Region: 612-675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 16 Region: 728-792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2368-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family EGF-type module 0.005
Further Details:      
 
Domain Number 18 Region: 2485-2526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000882
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 1886-2038
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 20 Region: 982-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000768
Family EGF-type module 0.026
Further Details:      
 
Domain Number 21 Region: 2481-2559,3080-3148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 22 Region: 2329-2374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000766
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 23 Region: 2413-2445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.019
Further Details:      
 
Domain Number 24 Region: 551-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000264
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 25 Region: 2449-2485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.022
Further Details:      
 
Domain Number 26 Region: 786-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000693
Family EGF-type module 0.014
Further Details:      
 
Domain Number 27 Region: 2146-2182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000765
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 28 Region: 1646-1686,1722-1749,1839-1899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000179
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 29 Region: 1186-1254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000236
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number 30 Region: 2097-2141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000399
Family EGF-type module 0.06
Further Details:      
 
Weak hits

Sequence:  FBpp0288558
Domain Number - Region: 1250-1296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000667
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 3372-3411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000683
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 3340-3377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00709
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 2883-2938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0737
Family Complement control module/SCR domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288558   Gene: FBgn0031879   Transcript: FBtr0290119
Sequence length 3557
Comment type=protein; loc=2L:complement(6973477..6973508,6973574..6973684,6973745..6975132,6975731..6975856,6975925..6976300,6976373..6981691,6981760..6983250,6983316..6983518,6983583..6985013,6987119..6987200,6999742..6999856); ID=FBpp0288558; name=uif-PB; parent=FBgn0031879,FBtr0290119; dbxref=FlyBase_Annotation_IDs:CG9138-PB,FlyBase:FBpp0288558,REFSEQ:NP_001137804,GB_protein:ACL83010,FlyMine:FBpp0288558,modMine:FBpp0288558; MD5=639b4c1d9facf1c3ef7dadfd954854e9; length=3557; release=r5.30; species=Dmel;
Sequence
MKQSTAANSHWLAALLSSLLLLNLLHLIGADEAFSCPNGWELRGLNCYKYFNIKHSWDKS
AELCRRYGAELVAIDSYAENNETLAIARASDPNQRASDKYWLGLASLDDLRTNTLESASG
ALISQYSGYWSLHQPNAESGECVAAAFAGKSQSWDLGTCESLLPFMCRAQACPQGSLHCA
NGKCINQAFKCDGSDDCGDGTDELDCPAQCHYHMQSGGDVIETPNYPHKYGALSKCKWTL
EGPLGSNIILQFQDFETEKTFDTVQILVGGRTEDKSVSLATLSGKQDLTTQPFVSASNFM
IVKFTTDGSVERKGFRATWKTEAKNCGGTLKATLQRQILTSPNYPKQYPGGLECLYVIKA
QPGRIISIEVDDLDIADGRDFLMIRDGESPMSRTIAKLTGKTAQNNRVIISTGNALYLYF
KSSLGEAGKGFSLRYIQGCKATITARNGTVTSPAFGLADYPKNQECYFTIRNNARAPLSL
KFDKFTVHKSDNVQVFDGSSTSGLRLHSGNGFTGPAAPKLTLTASSGEMLIKFTSDALHN
AAGWSATFSADCPELQPGIGALASSRDTAFGTLVSFTCPIGQEFATGKTRLVTECLRGGN
WSVSYIPKCQEVYCGPVPQIDNGFSIGSSNVTYRGIAMYQCYAGFAFASGAPIEKISCLP
DGRWERQPHCMASQCAALPEVAHANVTLLNGGGRSYGTIVQYECEPGYERNGHPVLTCMS
NGTWSGDVPRCTRKRCFEFPTIANGFVVDSTRAYLFGDEARVQCFKGYKLIGSNIMRCSE
AQKFEQPPTCEDINECSSSQCDLTTTECQNTNGSFHCQCRTGFTATTECRPVGDLGLGNG
GIPDDSITTSVSEPGYSKEQLRLNTNGWCGGSSEPGANWILIDLKAPTILRGFRTMSVQR
PDGNVAFSSAVRLQYTNDLTDVFKDYANPDGTAVEFRILEPTLSILNLPLPIEARYIRFR
IQDYVGAPCLRMELMGCTRLDCVDINECSKNNGGCDQKCINSPGGFACGCNTGYQLYTSN
GTAGYHIERSESGERDGDTYQRNKTCVPLMCPELEAPENGQLLSDKNDYHFGDVVRFQCH
FGYIMSGSSAALCLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPDPESVLVPFRDNV
TITCGSPGRQLRATASSGFRQCVYDPKPGLPDYWLSGMQPSCPRVDCYSPMPTPGAEYGQ
FVDTRYQSSFFFGCQNTFKLAGQTGRHDNVVRCGADGIWDFGDLRCEGPVCEDPGRPADG
RQIARSYEQSSEVYFGCNRPGYILINPRPITCIREPECKVIKPLGLSSGRIPDSAINATS
ERPNYEAKNIRLNSATGWCGKQEAFTYVSVDLGQIYRVKAILVKGVVTNDIVGRPTEIRF
FYKQAESENYVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFE
LMGCEEPKQEPLLGYDYGYSPCVDNEPPIFQNCPQQPIVVRRDENGGVLPVNFTEPTAVD
NSGSIARLEIKPQNFRTPSYIFKDTVVKYVAFDYDGNVAICEINITVPDVTPPLLQCPQS
YVIELVDRQDSYTVNFNDTRKRIKTSDDTGDVRLQFSPESANIKIGNFENVTVTATDKYN
NRAACHFQVSVKASPCVDWELQPPANGAINCLPGDRGIECIATCKPGFRFTDGEPLKTFS
CETSRLWRPTSVVPDCVSENTEQAAYHVTASITYRANGAVAQSCLGQYQEVLAQHYGGLN
QLLSQRCSAVNVNMNVTFVKSVPMLLEENVVKMDFILSILPAVRQPQLYDLCGSTLNLIF
DLSVPYASAVIDDLLNIANIGNQCPPLRALKSQISRGFNCNVGEVLNMDTSDVPRCLHCP
AGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSP
TGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGL
APCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVPMG
HDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCECPAGYSGINCQEEASD
CGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQCDVTIDPCTANGNPCGNGASCQALEQG
RYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLC
LSEPCKHGTCVDRLFDHECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCNCE
PGYTGKNCQHTIDDCASNPCQHGATCVDQLDGFSCKCRPGYVGLSCEAEIDECLSDPCNP
VGTERCLDLDNKFECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWS
GMRCEQQVTTCGAQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGK
CQDFGSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCE
QDIVDCKDNSCPPGATCVDLTNGFYCQCPFNMTGDDCRKAIQVDYDLYFSDPSRSTAAQV
VPFPTGEANSLTVAMWVQFAQKDDRGIFFTLYGVQSARMTQQRRMLLQAHSSGVQVSLFE
DQPDAFLSFGEYTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKMEYGAGGSLPGYLWA
VLGLPQPYGLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVRDCRSEPVLYPGLIL
NWAGYEVTSGGVERNVPSLCGQRKCPVGYTGANCQQLVVDKEPPVVEHCPGDLWVIAKNG
SAVVSWDEPHFSDNIGVTKIYERNGHRSGTTLLWGTYDITYIASDAAGNTASCSFKVSLL
TDFCPALADPVGGSQVCKDWGAGGQFKVCEIACNAGLRFSEPVPEFYTCGAEGFWRPTRE
PSMPLVYPSCSPSKPAQRVFRIKMLFPSDVLCNKAGQAVLRQKVTNSVNGLNRDWNFCSY
AIEGTRECKDIQIDVKCDHYRGTQNNRVRRQAKDGGVYVMEAELPVVNDPVVHTSTGERS
TVKQLLEKLILEDDQFAVQEILPNTVPDPASLELGSEYACPVGQVVMIPDCVPCAIGTFY
DSANKTCIACSRGTYQSEAGQLQCSKCPVIAGRPGVTAGPGARSAADCKERCPAGKYFDA
ETGLCRSCGHGFYQPNEGSFSCELCGLGQTTRSTEATSRKECRDECSSGQQLGADGRCEP
CPRGTYRLQGVQPSCAACPLGRTTPKVGASSVEECTLPVCSAGTYLNATQNMCIECRKGY
YQSESQQTSCLQCPPNHSTKITGATSKSECTNPCEHIAEGKPHCDVNAYCIMVPETSDFK
CECKPGFNGTGMACTDVCDGFCENSGACVKDLKGTPSCRCVGSFTGPHCAERSEFAYIAG
GIAGAVIFIIIIVLLIWMICVRSTKRRDPKKMLTPAIDQTGSQVNFYYGAHTPYAESIAP
SHHSTYAHYYDDEEDGWEMPNFYNETYMKDGLHGGKMSTLARSNASLYGTKEDLYDRLKR
HAYTGKKEKSDSDSEVQ
Download sequence
Identical sequences Q9VM55
FBpp0288558 NP_001137804.1.81976 NP_609091.4.81976 FBpp0288558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]