SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288682 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0288682
Domain Number - Region: 80-177
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288682   Gene: FBgn0001967   Transcript: FBtr0290243
Sequence length 224
Comment type=protein; loc=2L:complement(14019489..14020163); ID=FBpp0288682; name=nimC3-PB; parent=FBgn0001967,FBtr0290243; dbxref=FlyBase_Annotation_IDs:CG16880-PB,FlyBase:FBpp0288682,REFSEQ:NP_524928,GB_protein:AAF53369,FlyMine:FBpp0288682,modMine:FBpp0288682; MD5=2fe374da8590c05f57a38773c45c420d; length=224; release=r5.30; species=Dmel;
Sequence
MLQQVLYPMLVLVLMTIHLVEVSSLAITNGHCQKNISVKYQVPVAKTRMAGAGPPNASHP
IDLDSYVVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE
PSHHHTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERVQCGHE
QRFDPGRRACVQIEMSMEELMQRVAERLAKGLEAEEEAANEPES
Download sequence
Identical sequences Q9VJU2
FBpp0288682 FBpp0288682 FBpp0288682 NP_524928.2.81976 7227.FBpp0288682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]