SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288683 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288683
Domain Number 1 Region: 230-380
Classification Level Classification E-value
Superfamily TRAF domain-like 3.27e-41
Family MATH domain 0.000018
Further Details:      
 
Domain Number 2 Region: 4-68
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000245
Family SIAH, seven in absentia homolog 0.038
Further Details:      
 
Domain Number 3 Region: 154-197
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000517
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number 4 Region: 118-169
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000654
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0288683
Domain Number - Region: 64-117
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0017
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288683   Gene: FBgn0026319   Transcript: FBtr0290244
Sequence length 387
Comment type=protein; loc=2L:4378936..4380099; ID=FBpp0288683; name=Traf4-PD; parent=FBgn0026319,FBtr0290244; dbxref=FlyBase_Annotation_IDs:CG3048-PD,FlyBase:FBpp0288683,REFSEQ:NP_477417,GB_protein:AAN10343,FlyMine:FBpp0288683,modMine:FBpp0288683; MD5=cf86b308b41564890c2f19d7f7861d7f; length=387; release=r5.30; species=Dmel;
Sequence
MGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTM
RRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCA
HCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAG
CRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITD
WSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDA
LLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE
LLHSRPFIKGDTVFLRVKVDPSKIVAV
Download sequence
Identical sequences FBpp0288683 FBpp0288683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]