SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288780 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288780
Domain Number 1 Region: 84-364,462-532,612-815
Classification Level Classification E-value
Superfamily ARM repeat 2.52e-22
Family HEAT repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288780   Gene: FBgn0259876   Transcript: FBtr0299507
Sequence length 1351
Comment type=protein; loc=2R:join(9020819..9021064,9021135..9021311,9021388..9022202,9022262..9024362,9029167..9029322,9029606..9030166); ID=FBpp0288780; name=Cap-G-PF; parent=FBgn0259876,FBtr0299507; dbxref=FlyBase:FBpp0111651,FlyBase_Annotation_IDs:CG34438-PB,FlyBase_Annotation_IDs:CG17054-PB,GB_protein:AAS64860.1,FlyBase:FBpp0089198,FlyBase_Annotation_IDs:CG34438-PF,REFSEQ:NP_995827,GB_protein:AAS64860,GB_protein:AAS64860,FlyMine:FBpp0288780,modMine:FBpp0288780; MD5=1592e8f050432147aa07092853bd9898; length=1351; release=r5.30; species=Dmel;
Sequence
MAKPKAKAGETEKPKTKAAGGKKRLAATKKTKKDGEKENEDQSVATTSDTSAELMYAIMR
QAELKESLHKRYSKEMQQLYAKMGHESFRKAFINVLKAVLGAEEGNENANMALNFCATFV
TSSDSDGTEPMLAETFHWLLTTYSSNPHIRYRICYFVNLILKELGPNAALDDHQCDDILE
AMLDRVKDVSASVRKQAVLAMQRLQNPDNPSDVVVGAYMYHLTSDPSPNVRQCIITCMGR
NYITIPHILERLWDVDEKVRRHTYVNMCNYPVRSYKVAQRLTLLEQGLNDTSATVRKTVI
NFMLKTWIESYQQNYVALIAALKLDSNEEELLRFRRVAKQMLRVIFQQTDIKQLIDQLPL
SEDCELHRCIPHDSVTVELLLYWQCLSEYLETEAPEIESLLPELSVFCTYMDKFCQFQKP
DMDKFAQVEFQNMLLSLVEILETYDLGDEIGRGNMRLLITNLLKDCLLDHKIVRVLVRCM
EQLITDTNDRIQYFIEIIYELCELNTKQNDLIHDRSLINKLLDDLDTPLKMKISSLKVKI
LELEELEGNYVRQREYIRAQSVNDEKIAVTEEYTELIRPLLEKHGVIEMPTRPKLSKQER
VLKGLYISYYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTFSIFYEA
YSREVFEVVVVQFCKNNNVRLCEASANCILELLDRYGVDYFNDLNQTGGSLSKTKRRQLY
TMQELYDDDDGSQSQNNEQNSDILVVLGHYLERVQHRGVGMAIVRGLCRLVLRGHVDDRT
DVLELLLKRYFNPNTEPIINQVLGLFFEELRRLNKHSLLQPCFLPTVWTCNYDSPLHGVQ
PEHLTKFFLEMTVQEMSTPQTNIHNKIAISFLQYIQNYFTERKDMCRLLAKELTNLSINV
LNGPEVKAELLALAENLIQSELDPRMIKCIQNFKLVVNGSFNPPPRRNPDEGESDEEYET
ATVTTAESETAVPAQSQPPVTEESPNDVTQSAAITAVDATETPKAAAPPAPVPEPIVTTF
GKDNIVGIRHLRRSMAISHSDAESLLGPQSPNPEESTESEAVETSKQNLRQPQMRRRLEM
AIARSSKTPEKQPSTEEESSDEEISESPNAANKSNDSEVIEASPTAASPSPRAGHEASHL
RIRSLRIRKVASTSTSQTTPKPVSKRKVVHLETPLRNGRKRVLRRSPSNSNSRSLRSRDS
TALSSPRVSPRRKQQRLDNRSTRRQQMTKNTNSPTDSTSSVKENQIPPVIVIELDSDTES
ESNAKPESTPPKKPLKKTIPLIRSRPSSSTPKVTTRNEARAQRMNSKVMTRKRMSLEMNL
SGGQLQVSTPKRVTRAVALSMSTDGKRSRRK
Download sequence
Identical sequences A1Z987
FBpp0288780 NP_995827.2.81976 7227.FBpp0288780 FBpp0288780 FBpp0288780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]