SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288820 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288820
Domain Number 1 Region: 997-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-35
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1685-1796
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-30
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 3 Region: 623-739
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 501-625
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 5 Region: 2960-3075
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-23
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1232-1342
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 1461-1575
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-18
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 8 Region: 1339-1457
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-18
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 9 Region: 2141-2253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-18
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2259-2373
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-17
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 1925-2024
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-17
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 12 Region: 1114-1227
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-16
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 
Domain Number 13 Region: 857-964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000236
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 14 Region: 744-855
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000288
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 15 Region: 3453-3539
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000102
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 16 Region: 155-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 17 Region: 2747-2843
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000119
Family Spermadhesin, CUB domain 0.0053
Further Details:      
 
Domain Number 18 Region: 461-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000122
Family EGF-type module 0.015
Further Details:      
 
Domain Number 19 Region: 2026-2143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000013
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 20 Region: 290-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000275
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 192-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000032
Family EGF-type module 0.01
Further Details:      
 
Domain Number 22 Region: 2616-2714
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000055
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 23 Region: 425-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000876
Family EGF-type module 0.013
Further Details:      
 
Domain Number 24 Region: 3098-3197
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000144
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 25 Region: 2859-2957
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000222
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 26 Region: 1582-1669
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000968
Family Spermadhesin, CUB domain 0.0083
Further Details:      
 
Domain Number 27 Region: 2375-2507
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000481
Family Spermadhesin, CUB domain 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0288820
Domain Number - Region: 3230-3319
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000458
Family Spermadhesin, CUB domain 0.008
Further Details:      
 
Domain Number - Region: 3322-3411
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number - Region: 322-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 247-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288820   Gene: FBgn0259140   Transcript: FBtr0299545
Sequence length 3545
Comment type=protein; loc=3L:complement(11795185..11795396,11795454..11795751,11795813..11795964,11796021..11796162,11796214..11796393,11796501..11798847,11798981..11800743,11800813..11800970,11801030..11801912,11802008..11803325,11803390..11803588,11804003..11804237,11804297..11804481,11804645..11806548,11806612..11806718,11807079..11807633); ID=FBpp0288820; name=CG42255-PA; parent=FBgn0259140,FBtr0299545; dbxref=FlyBase_Annotation_IDs:CG42255-PA,FlyBase_Annotation_IDs:CG32092-PB,FlyBase:FBpp0075814,FlyBase:FBpp0288820,FlyBase:FBpp0075813,FlyBase_Annotation_IDs:CG32094-PA,REFSEQ:NP_729748,GB_protein:AAF50006,FlyMine:FBpp0288820,modMine:FBpp0288820; MD5=aeebcde4a46682ad8350cb89cc1312de; length=3545; release=r5.30; species=Dmel;
Sequence
MLIKSLKCLFLLVFCLQFPHSNTSRDNLEKRAHLVRQSNDNLLLEPAWDRNVSLRLMGES
ATVTINDVDMMTVLRRRQRIIADRQAARREPLKVDAVRDMFHDVELKMTRIQRRIFSARN
STKRSGLNQRILRRQLQRVERVKGILQTLAGNLARNECLSNPCKNGGTCHDAYKGFQCEC
PAGWQGDSCEDDVNECFTLAGTDLDGCLNNGQCINTPGSYRCVCRNGFTGTHCRLRHNTC
LFGGSRELCGEHGTCIQAANSAGYVCICDQGWTWADANVTSASPSACVRDVDECEPRVNP
CHDECINLPGSFRCGACPTGYTGDGRFCRDIDECASEDNGGCSLQPRVTCTNTEGSHRCG
RCPAGWTGDGRTCTASDSNSCNNEGICHPLAKCEYVSDMVVCTCPLGSFGHGYGADGCSA
DSSRLPCDQHPCQNNGTCVQNGRGTTCICQPGYSGVVCNSSDACHPSPCLNGGTCRLLPD
AKYQCVCPRGYTGTTCSHQRFFCGVTIRGPSGQLHYPPNTADGDYQADERCPFIIRTNRN
MVLNLTFTQFQLEDSADCTADFLQLHDGNSLSSRLIGRFCGSRLPMTNGSVITTQEQVFF
WFRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQTGVLRSPGYPGQARPELDCRWQLTAP
FGYRLLLRFYDISLGSSEASAGNCSQDSLIVYDSDRQLLRACQSIQPPPVYSSSNSLRLD
FHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISGYMNFEVCLYLIEQPRGTQVKLV
IDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGNVILVRYEYAL
SGVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRIT
DLSLGTANNENDTSYLDVYLSADQKRHIVKSTDNLILLSHSNRASLVFHGSGGGRGMRLE
YNFVPNQCGGFLNEPGRRYVTAVRGTFCQWFIDFPDSCGGTFTARFGYIKSPNWPKNYGE
SQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEI
PSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGI
LACDWQIIVAEGSRVSLQLRSNDNRICSGQLTLYDGPTTASNPIVIRCNGTIAKPLQSTG
NRVLVRYDVGHDAPDGTDFMLNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAG
GRKNHLQLIFSHLSVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLL
LRFKSDSSVELQGFRAEYKRIGCGEHLRESGGRFESPNAPFSVDMDCVWIITASEGNQIR
LLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRF
VSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTV
EVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRIVHGRK
LRVRFKSQAGTWGRFIMYFERQCGGRLSTGEGYLQSRLDEECSWLVTSPEGSKLSLIINQ
LECPKCNAVSQNCSEGLQLLNDDDQVLLYQMCRDHPANLIVPANNVRILTHGIRLQAQFS
TFENSCGGNITSASGSLSSPNYPDSYPANIECVWSIRTRPGNALEITFEAMDIVRSEHCN
DDFLEIRSSVQGPLLALYCDKNLPETPLVVHSELWIKFRSRPGNTAGGFRFRWTYVHNNE
INSGINGTIEPPPPLFVSNEDQPFTWRLFTDFKKVFVLQFEEYISGLILFDGYDDNALAV
NIPVSPWRFTSSSNVVYLKTVNDALTHFRLKWGVLDSNLVASNLSLTTGGCTKELTLSHH
GDIELSSPGYPHGYAPNLNCEWTIRSQFPSHHIYAHSIIVDLEDYPACSADYLSIQSSRD
LIKWKNELHACKASQIAPVHGTPYLRLQFRSDVSINGTGFRAKLRTSCGSNMTGIVGTIP
QENLFDECAWHIDVRPGRKIDIAINYNNMPPIAVCEAYGLIYDGVDEHASLLEHTRFGNQ
MGIRRTQFRTSGSHAYIKYHIGRSRINGLCLWNLTYREFNECNGEIQLNQQAPNYTIMSP
GYPYLPHPHAECTWLVMAPPGETIAVDFDEQFELSARHCDKENVEFFDGATKLARLLLRT
CRKPQNTVRTTGNLLLVHYQSQLNEPTGGFRLNLSLSTCGGQFSASAGFISSENYPHLGG
YPKPSVCEYSILLPKNAFIRLNITDLHLPYDANGTSSDRLEIVDYEDRTQKLMVLDGRTK
TSILFTLNTNAATIRFVAVQNVNNYRGFKIRYERYVGTCSRDINGASGDIVIPPMPQSVW
LRFCRLRISVPKGQRVRLNLLNLSNIRVVKRNDTNRSFMQIGRLESMAHFSFYNDANSLS
KIAEFRIDGGYNGSGIIESTDNYMLVVVMTNQLDLSATPLRARYSSSEPTVCPPNIGDQA
TGSISIQSLLQVPGYHCTIKFVGTDSATLTFKVEEYLFQTAGGPAVVFRDDITNIPVKAM
YANVTNSFVSVVTSAGSVTLLNSKNVKLRRFRATYRRHNCGGRLQAAEGVTIESPDLLTT
LNDAYGEVECLWTLSNSNGYVLEGNVTLTDRCDREYIVIFSGQSEVGRICRGMAMNSTLL
ERPFSTILYHSESRLAQQSKFILQAWKSVSSGNAIRIDHRPSPPVTISSKNYLESKQRIW
EFVTNDGLSLRLHFLERIFIVSSPNCSTDRLTVERYDQTTEEYIEVTSLCGRQAANDILV
PSARMRVIFQTNSNITGDGFSFQVIPSCDSVLLAGAEIQTLASPSWAAFRGRQFNCSYTF
YAHDNHQVVVSVRTRGRPWASYACSRSYFEAYRRGDGNGVGEESIGRLCPEFEVKGNGRV
RLRYVSPLSRWFEMQYQLIQCGGNYSTSFTLRPPQNEDSSVYAHNTLCEWRITAPPQHAV
VIEFKYFDMESSRNCGFDSLTIYRGHVVSEEQRTGLLCGNVTNPETIIVNSNEALIVLTT
DSSNSYRGFLASVRFTPNCNEHVALDLEVPRMSVMRQYVVNISESLLCIFQASAPPDYRI
SLEVRKLQLADDVVCRTCSYLEIHDSKDVEGQNLGRYYGGTNGNEPSNRTKVFSSFSDMS
FKLIATTGQAQKNISFELILQMVRTVCGQGEYDLRLNETITLGMQYDNSTRFYEGSIQCL
WIIKNKGDVELEFRKLRLKEISQGTGKCTDYLKLSKPYFSRSYCGQHDKSFKIVEEVNES
NLQLAFHSDGLEESQGFEVIIRRKSTCNRNYTELSQVIDTSNLTNCTDYIRVPRGYSITL
YVMTVLFDSFDNNYFRVIDVQSNKTIFTNSDIQWETKAMITSTNELRLESRQVSSLKFFY
FSTSNQFPGGCGGDLAVGGSVGSYLENPSYEGRNSSLCTWKISVPAGGSLRFSFAEFNMG
SESNCDLDNVRFYDSVVDDQRLVKAICGSRIPDMFTIAKNNVIIVAKKSQNFDGLGFRMD
IIEIG
Download sequence
Identical sequences FBpp0288820 7227.FBpp0288820 FBpp0288820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]