SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288974 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288974
Domain Number 1 Region: 37-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000134
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-36
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000128
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288974   Gene: FBgn0259209   Transcript: FBtr0299696
Sequence length 92
Comment type=protein; loc=2R:join(19962746..19962860,19962972..19963135); ID=FBpp0288974; name=Mlp60A-PE; parent=FBgn0259209,FBtr0299696; dbxref=FlyBase:FBpp0288974,FlyBase:FBpp0072089,FlyBase_Annotation_IDs:CG33149-PA,FlyBase_Annotation_IDs:CG42309-PE,REFSEQ:NP_788435,GB_protein:AAF47158,FlyMine:FBpp0288974,modMine:FBpp0288974; MD5=bd635b9d788e72e455ae90a5d6b40712; length=92; release=r5.30; species=Dmel;
Sequence
MPFVPVETPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCK
NCHGRKYGPKGYGFGGGAGCLSTDTGAHLNRE
Download sequence
Identical sequences A0A0B4LGF8 B4I2C8 P53777 Q6XIG1
FBpp0288974 7245.FBpp0259381 FBpp0259381 FBpp0199778 FBpp0288974 NP_001286820.1.81976 NP_788435.1.81976 XP_002037505.1.34323 XP_016930612.1.48971 XP_017005593.1.47939 XP_017125171.1.32376 XP_017125172.1.32376 XP_017125173.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]