SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289137 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289137
Domain Number 1 Region: 1636-1909
Classification Level Classification E-value
Superfamily YWTD domain 2.48e-17
Family YWTD domain 0.0079
Further Details:      
 
Domain Number 2 Region: 1033-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000516
Family EGF-type module 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0289137
Domain Number - Region: 1284-1353
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000432
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 1104-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000767
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 1003-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 1134-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 639-779
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 276-319
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00418
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 
Domain Number - Region: 1162-1198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 938-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 967-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289137   Gene: FBgn0259240   Transcript: FBtr0299859
Sequence length 3378
Comment type=protein; loc=X:join(12087914..12088256,12089802..12090656,12091219..12091288,12167968..12168273,12170545..12170651,12179534..12180739,12180893..12181087,12182999..12183208,12185693..12185878,12189223..12189369,12189510..12189717,12206825..12206944,12210797..12210964,12211246..12211438,12212076..12213460,12215948..12216492,12221324..12225216); ID=FBpp0289137; name=Ten-a-PE; parent=FBgn0259240,FBtr0299859; dbxref=FlyBase:FBpp0289137,FlyBase_Annotation_IDs:CG42338-PE,REFSEQ:NP_001138189,GB_protein:ACL82921,FlyMine:FBpp0289137,modMine:FBpp0289137; MD5=e9c70d11d4113b5d06e317bd916b4a83; length=3378; release=r5.30; species=Dmel;
Sequence
MSSSHSGTIGRKRVGSGSAAGSEYYYASGGLGGLTGSSNGGGNGGGEQLRRQRSAEWHSH
GRHGHGHGLSHGMGHGMGHGYGSSSEDEYQNTGQATAFDTQLLAQLLLQSQQLASMEHYN
SDCEPDYLRQRDRHHEEATPLGDGTPTVTAAAPEVTYAQPHQQRSTMPAGSPLKVSTVSA
GKYQSNANLGLFPNSSSSGGSSVQNGVTAHTPRSTNPFLNGSTKFASDDGGLENINMLKP
SASSSTAASSSIRSSHRNRNALNRLSGMTSSSSDSQTHHHQQQQQQQQQQQQQQQQQQLQ
ISQQQQQQIAAVKQQQQMLPPEDSGDDDFVLGLGSLELGNCSSGGESEEPPPEPAPPEIP
PRTQSLLMSLRKHSDYKLKYEEKGDQKHEEFIPTSQLQKDYILSDNLRSDQQLKPISPGD
SNGLGGHPQQMPQSMSTGSNTIGHGGIDRGGVGLPMGAGTMPGGVGGGPGGVAGGGPQVG
VGPPGSGNGGNCQISGSQPLVMPGFPLRNSHSAHAPHYSPYSPSRFHIDKRCQHRCSWKC
LSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILVQDVKSQPHDLRGGLAKSNEKGVA
TAFPTEESIQTSTSDHGQNGHGLMNPSAGSGGSNSGIQQQLLLQQQQPHSINQPLTPLDA
TNTHLQDHHQLTYGGALPGGVGGIGMSGGGIMNGGLNGGLGGQLMQQPGGGLNGHHHQAL
QPQLGGVVELKEFNEAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVA
PSVTQHDFVEFIKGGRLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQDSEQDE
SRSFDSSESYDVETPLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQY
LDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDC
SKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGW
KGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLE
TGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQ
CKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIALELNC
KDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVTASFYQRVKFL
IEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQGGWFD
VLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVAPLNP
ALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFAETQIV
QESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEA
DPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIG
GWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAK
LLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYI
SDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHPKGLA
IAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLA
LSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTVLAMA
FSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGSATNSG
VGGAGGSAYSTTVNPTRPNGGTTPTTPSGGNGNGNGNGSSATSSGGSVGGSNGSGGGANG
GACICAGGIALSTGTGSSSGSNGGGTLASIVGSGGLMSTGPTTTTTVLLGAKTTAAGIGA
ATLNDDGTLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENG
EFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQF
LRDYSNVVSSIENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSRSSGGET
YIYQYDEFGRVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLV
LGGVRSTFLKRGQAHADAELKANNTLVIHGDNGVVVEASAVARHPLLEAALPVEAEMLAM
WSHQSVTMGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRETFYD
ARRTPILIVAYDQSGLPKSYYPTNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHGLLSE
ITSQQDGIVSFVYNDWNLVSEIGLASQRKFVLQYDDAGGLRHVVLPSGTRHSFSMQTSIG
FIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGRSEFQ
YNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYEYDSQLRVV
ALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTVDGRFQT
QRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDCDGQLVGVEAQ
EPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYKYDARGLVAQNAREERFHY
NTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIYSPRDG
KLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSN
PYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLHLYRFN
GNDPINVGHERHYPEDFAAWMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVALNLRR
PFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTIGSDTEPPFGKG
IVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVKEDAWR
ATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGGAGSSSSSSSSSGGGSSSNTGN
YLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTALEWSQ
QETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFVKKKGATGGAAGVPNSRRRRRR
STDLIQEEEEELHREADC
Download sequence
Identical sequences B7Z145
FBpp0289137 7227.FBpp0289137 FBpp0289137 FBpp0289136 NP_001138189.1.81976 NP_001162730.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]