SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289272 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289272
Domain Number 1 Region: 225-333
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-22
Family UBX domain 0.00034
Further Details:      
 
Domain Number 2 Region: 151-240
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.53e-22
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00029
Further Details:      
 
Domain Number 3 Region: 4-39
Classification Level Classification E-value
Superfamily UBA-like 0.0000051
Family TAP-C domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289272   Gene: FBgn0259729   Transcript: FBtr0299995
Sequence length 353
Comment type=protein; loc=2R:complement(20311478..20312539); ID=FBpp0289272; name=CG42383-PA; parent=FBgn0259729,FBtr0299995; dbxref=FlyBase:FBpp0289272,FlyBase:FBpp0072266,FlyBase_Annotation_IDs:CG4556-PA,FlyBase_Annotation_IDs:CG42383-PA,REFSEQ:NP_523847,GB_protein:AAF47202,FlyMine:FBpp0289272,modMine:FBpp0289272; MD5=ae906a0f2975433a19da3afece3785af; length=353; release=r5.30; species=Dmel;
Sequence
MTDEQKLSTFMKRHGVREEVARQYLSSNNWSLEVASSTYESEAVSKKQEPEKSSEHSQAN
ESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTPAGKRVNINSSTPAITNNDSDRS
LRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIVVLHLWSEGFSLDDGSLRLYAL
PENERFLRAILRGDFPEEMLRVPRVQLSVQDHTNESYRHLSRKQFMGPGRPLNSPSPQIL
VVGPMPVEAQGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDR
SFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEPLSSDASEPIVQ
Download sequence
Identical sequences Q9W175
FBpp0289272 NP_523847.2.81976 FBpp0289272 FBpp0289272 7227.FBpp0289272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]