SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289415 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289415
Domain Number 1 Region: 292-350
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Domain Number 2 Region: 102-174
Classification Level Classification E-value
Superfamily PA domain 0.0000000261
Family PA domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289415   Gene: FBgn0004919   Transcript: FBtr0300178
Sequence length 461
Comment type=protein; loc=2R:complement(20962441..20962861,20962920..20963071,20963128..20963245,20964697..20964829,20964893..20965454); ID=FBpp0289415; name=gol-PC; parent=FBgn0004919,FBtr0300178; dbxref=REFSEQ:NP_523864,GB_protein:AAF47316,FlyBase:FBpp0289415,FlyBase_Annotation_IDs:CG2679-PC,FlyMine:FBpp0289415,modMine:FBpp0289415; MD5=207ed1d7be4facf578d933fc8390c669; length=461; release=r5.30; species=Dmel;
Sequence
MYIRKTLLLACLVLLFGGLPPLTFPATTTTLVAAMSIANQDLERYFRPGNGTHSFSGMED
RIAVDVYNYAFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDY
ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEK
MQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSI
SFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDS
DCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVVGDQIY
QTPSPQHTAPIASIEEVPVIVVAVPHGPQPLQPLQASNMSSFAPSHYFQSSRSPSSSVQQ
QLAPLTYQPHPQQAASERGRRNSAPATMPHAITASHQVTDV
Download sequence
Identical sequences A0A0B4K8B7
NP_001246517.1.81976 NP_523864.3.81976 FBpp0289415 FBpp0289415 FBpp0297426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]