SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289438 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289438
Domain Number 1 Region: 1146-1411
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000000000157
Family Soluble quinoprotein glucose dehydrogenase 0.017
Further Details:      
 
Domain Number 2 Region: 557-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000324
Family EGF-type module 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0289438
Domain Number - Region: 808-877
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000353
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 628-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000481
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 527-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000617
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 658-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 163-303
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00314
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 686-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 462-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 491-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0345
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289438   Gene: FBgn0259240   Transcript: FBtr0300201
Sequence length 2902
Comment type=protein; loc=X:join(12124258..12124403,12170545..12170651,12179534..12180739,12180893..12181087,12182999..12183208,12185693..12185878,12189223..12189369,12189510..12189717,12206825..12206944,12210797..12210964,12211246..12211438,12212076..12213460,12215948..12216492,12221324..12225216); ID=FBpp0289438; name=Ten-a-PG; parent=FBgn0259240,FBtr0300201; dbxref=FlyBase:FBpp0289438,FlyBase_Annotation_IDs:CG42338-PG,REFSEQ:NP_001162729,GB_protein:ACZ95264,FlyMine:FBpp0289438,modMine:FBpp0289438; MD5=83ee41a0fd3cf3b8f32d18258eedcf58; length=2902; release=r5.30; species=Dmel;
Sequence
MTMKSMKYSDCDTIMDGYNPVPPPLPRRVPPVRNIYAEPFAHEPNHSSRFHIDKRCQHRC
SWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILVQDVKSQPHDLRGGLAKSNE
KGVATAFPTEESIQTSTSDHGQNGHGLMNPSAGSGGSNSGIQQQLLLQQQQPHSINQPLT
PLDATNTHLQDHHQLTYGGALPGGVGGIGMSGGGIMNGGLNGGLGGQLMQQPGGGLNGHH
HQALQPQLGGVVELKEFNEAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSR
RNVAPSVTQHDFVEFIKGGRLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQDS
EQDESRSFDSSESYDVETPLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVS
LLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQ
GVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHC
ERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGT
YDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCS
EHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIAL
ELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVTASFYQR
VKFLIEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQG
GWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVA
PLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFAE
TQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVK
TYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDI
SDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGVA
KDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADG
HLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHP
KGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWP
TGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTV
LAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGSA
TNSGVGGAGGSAYSTTVNPTRPNGGTTPTTPSGGNGNGNGNGSSATSSGGSVGGSNGSGG
GANGGACICAGGIALSTGTGSSSGSNGGGTLASIVGSGGLMSTGPTTTTTVLLGAKTTAA
GIGAATLNDDGTLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSH
DENGEFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGN
KIQFLRDYSNVVSSIENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSRSS
GGETYIYQYDEFGRVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEAN
ELLVLGGVRSTFLKRGQAHADAELKANNTLVIHGDNGVVVEASAVARHPLLEAALPVEAE
MLAMWSHQSVTMGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRE
TFYDARRTPILIVAYDQSGLPKSYYPTNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHG
LLSEITSQQDGIVSFVYNDWNLVSEIGLASQRKFVLQYDDAGGLRHVVLPSGTRHSFSMQ
TSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGR
SEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYEYDSQ
LRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTVDG
RFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDCDGQLVG
VEAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYKYDARGLVAQNAREE
RFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIYS
PRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIV
YDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLHL
YRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVAL
NLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTIGSDTEPP
FGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVKE
DAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGGAGSSSSSSSSSGGGSSS
NTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTAL
EWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFVKKKGATGGAAGVPNSRR
RRRRSTDLIQEEEEELHREADC
Download sequence
Identical sequences E1JJM6
FBpp0289438 NP_001162729.1.81976 FBpp0289438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]