SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289439 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289439
Domain Number 1 Region: 1506-1795
Classification Level Classification E-value
Superfamily NHL repeat 1.44e-19
Family NHL repeat 0.0093
Further Details:      
 
Domain Number 2 Region: 918-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0289439
Domain Number - Region: 1169-1238
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000392
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 989-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000739
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 888-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000935
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 1019-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 161-204
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 
Domain Number - Region: 524-664
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 1047-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0139
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 823-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 852-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289439   Gene: FBgn0259240   Transcript: FBtr0300202
Sequence length 3263
Comment type=protein; loc=X:join(12089804..12090656,12091219..12091288,12167968..12168273,12170545..12170651,12179534..12180739,12180893..12181087,12182999..12183208,12185693..12185878,12189223..12189369,12189510..12189717,12206825..12206944,12210797..12210964,12211246..12211438,12212076..12213460,12215948..12216492,12221324..12225216); ID=FBpp0289439; name=Ten-a-PH; parent=FBgn0259240,FBtr0300202; dbxref=FlyBase:FBpp0289439,FlyBase_Annotation_IDs:CG42338-PH,REFSEQ:NP_001162730,GB_protein:ACZ95265,FlyMine:FBpp0289439,modMine:FBpp0289439; MD5=c3633a5fe69b9693ca7105322b9863c8; length=3263; release=r5.30; species=Dmel;
Sequence
MEHYNSDCEPDYLRQRDRHHEEATPLGDGTPTVTAAAPEVTYAQPHQQRSTMPAGSPLKV
STVSAGKYQSNANLGLFPNSSSSGGSSVQNGVTAHTPRSTNPFLNGSTKFASDDGGLENI
NMLKPSASSSTAASSSIRSSHRNRNALNRLSGMTSSSSDSQTHHHQQQQQQQQQQQQQQQ
QQQLQISQQQQQQIAAVKQQQQMLPPEDSGDDDFVLGLGSLELGNCSSGGESEEPPPEPA
PPEIPPRTQSLLMSLRKHSDYKLKYEEKGDQKHEEFIPTSQLQKDYILSDNLRSDQQLKP
ISPGDSNGLGGHPQQMPQSMSTGSNTIGHGGIDRGGVGLPMGAGTMPGGVGGGPGGVAGG
GPQVGVGPPGSGNGGNCQISGSQPLVMPGFPLRNSHSAHAPHYSPYSPSRFHIDKRCQHR
CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILVQDVKSQPHDLRGGLAKSN
EKGVATAFPTEESIQTSTSDHGQNGHGLMNPSAGSGGSNSGIQQQLLLQQQQPHSINQPL
TPLDATNTHLQDHHQLTYGGALPGGVGGIGMSGGGIMNGGLNGGLGGQLMQQPGGGLNGH
HHQALQPQLGGVVELKEFNEAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYS
RRNVAPSVTQHDFVEFIKGGRLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQD
SEQDESRSFDSSESYDVETPLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNV
SLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGY
QGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECH
CERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHG
TYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRC
SEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGRDCSIA
LELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVTASFYQ
RVKFLIEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQ
GGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKV
APLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFA
ETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHV
KTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVD
ISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGV
AKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPAD
GHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSH
PKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQW
PTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGT
VLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGS
ATNSGVGGAGGSAYSTTVNPTRPNGGTTPTTPSGGNGNGNGNGSSATSSGGSVGGSNGSG
GGANGGACICAGGIALSTGTGSSSGSNGGGTLASIVGSGGLMSTGPTTTTTVLLGAKTTA
AGIGAATLNDDGTLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPS
HDENGEFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASG
NKIQFLRDYSNVVSSIENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSRS
SGGETYIYQYDEFGRVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEA
NELLVLGGVRSTFLKRGQAHADAELKANNTLVIHGDNGVVVEASAVARHPLLEAALPVEA
EMLAMWSHQSVTMGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNR
ETFYDARRTPILIVAYDQSGLPKSYYPTNGYPVNITYDRFNRVEGWAWGPAELKYSYDRH
GLLSEITSQQDGIVSFVYNDWNLVSEIGLASQRKFVLQYDDAGGLRHVVLPSGTRHSFSM
QTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDG
RSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYEYDS
QLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTRTVD
GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDCDGQLV
GVEAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYKYDARGLVAQNARE
ERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIY
SPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHI
VYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLH
LYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVA
LNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTIGSDTEP
PFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVK
EDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGGAGSSSSSSSSSGGGSS
SNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTA
LEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFVKKKGATGGAAGVPNSR
RRRRRSTDLIQEEEEELHREADC
Download sequence
Identical sequences FBpp0289439 FBpp0289439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]