SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289447 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289447
Domain Number 1 Region: 125-243
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.02e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 45-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289447   Gene: FBgn0031117   Transcript: FBtr0300210
Sequence length 268
Comment type=protein; loc=X:join(20338707..20338797,20339574..20339720,20340063..20340485,20340547..20340692); ID=FBpp0289447; name=CG1702-PB; parent=FBgn0031117,FBtr0300210; dbxref=REFSEQ:NP_001162808,GB_protein:ACZ95341,FlyBase:FBpp0289447,FlyBase_Annotation_IDs:CG1702-PB,FlyMine:FBpp0289447,modMine:FBpp0289447; MD5=f08c85a29a74fe90e69c504fc21fb186; length=268; release=r5.30; species=Dmel;
Sequence
MSVSFLASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALF
IIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAK
GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFR
MQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKR
VRQSCNPYYDVAHEFVYKISGTGPQAKL
Download sequence
Identical sequences E1JJS1
FBpp0289447 FBpp0289447 7227.FBpp0289447 FBpp0289447 NP_001162808.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]