SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289503 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289503
Domain Number 1 Region: 18-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.12e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289503   Gene: FBgn0032445   Transcript: FBtr0300275
Sequence length 232
Comment type=protein; loc=2L:join(12693083..12693402,12693466..12693844); ID=FBpp0289503; name=CG6153-PB; parent=FBgn0032445,FBtr0300275; dbxref=REFSEQ:NP_001162966,GB_protein:ACZ94252,FlyBase:FBpp0289503,FlyBase_Annotation_IDs:CG6153-PB,FlyMine:FBpp0289503,modMine:FBpp0289503; MD5=ff86f5b3548ef702f3048b5cfc6ce2ef; length=232; release=r5.30; species=Dmel;
Sequence
MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEK
RQDLSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDAR
AKPDQEFQLTRDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGKLTTIYVLS
VFPTKTKSLFKGLRGEFTEAHYHGVTICNYESRANAADHKEKAFDGVGRAIQ
Download sequence
Identical sequences FBpp0289503 FBpp0289503 7227.FBpp0289503 FBpp0289503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]