SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289553 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0289553
Domain Number - Region: 24-99
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00345
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289553   Gene: FBgn0259966   Transcript: FBtr0300323
Sequence length 139
Comment type=protein; loc=2R:complement(11080244..11080509,11080573..11080726); ID=FBpp0289553; name=Sfp51E-PA; parent=FBgn0259966,FBtr0300323; dbxref=REFSEQ:NP_001163157,GB_protein:ACZ94429,FlyBase:FBpp0289553,FlyBase_Annotation_IDs:CG42476-PA,FlyMine:FBpp0289553,modMine:FBpp0289553; MD5=e263b6ab2590e1a6015b12dd34ef018e; length=139; release=r5.30; species=Dmel;
Sequence
MIRKYLVLILVLGFLHLTWSSSGSCKDGLVFNPKKRVCEPKPTTEPPDTCRPGTYWILEK
KSCIKLRQVMSGYFPAKPEKPIQDLKCPKGLISLGNLCVRELKIKKKSQGSGKNGIEVDM
DDKYKIVIKEKQTDPPLDA
Download sequence
Identical sequences B4ZJ99
7227.FBpp0289553 NP_001163157.1.81976 FBpp0289553 FBpp0289553 FBpp0289553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]